Align Glyoxal reductase; GR; Methylglyoxal reductase; EC 1.1.1.-; EC 1.1.1.283 (characterized)
to candidate SMc00101 SMc00101 oxidoreductase
Query= SwissProt::O32210 (276 letters) >FitnessBrowser__Smeli:SMc00101 Length = 275 Score = 176 bits (446), Expect = 5e-49 Identities = 95/264 (35%), Positives = 157/264 (59%), Gaps = 3/264 (1%) Query: 13 NGVEMPWFGLGVFKVENGNEATESVKAAIKNGYRSIDTAAIYKNEEGVGIGIKESGVARE 72 NG +P G G F++ +G E + A+K G+R +DTA IY NE VG I++SG+ R Sbjct: 7 NGANIPALGFGTFRM-SGAEVLRILPQALKLGFRHVDTAQIYGNEAEVGEAIQKSGIPRA 65 Query: 73 ELFITSKVWNEDQGYETTLAAFEKSLERLQLDYLDLYLIHWPGKD-KYKDTWRALEKLYK 131 ++F+T+KVW ++ ++ +A+ ++SL +L+ D++DL L+HWPG D + AL ++ Sbjct: 66 DVFLTTKVWVDNYRHDAFIASVDESLRKLRTDHVDLLLLHWPGSDVPMAERIGALNEVRN 125 Query: 132 DGKIRAIGVSNFQVHHLEELLKDAEIKPMVNQVEFHPRLTQKELRDYCKGQGIQLEAWSP 191 GK+R IG+SNF +EE + ++ NQVE+HP L Q ++ + G+ L ++ Sbjct: 126 AGKVRHIGISNFNTTQMEEAARLSDAPIATNQVEYHPYLDQTKVLQTARRLGMSLTSYYA 185 Query: 192 LMQGQLLDNEVLTQIAEKHNKSVAQVILRWDL-QHGVVTIPKSIKEHRIIENADIFDFEL 250 + G++ + +LT+I +H K+ AQV LRW + Q V+ + K+ E R+ EN IFDF L Sbjct: 186 MANGKVPADPLLTEIGGRHGKTAAQVALRWLVQQQDVIVLSKTATEARLKENFAIFDFAL 245 Query: 251 SQEDMDKIDALNKDERVGPNPDEL 274 ++E+M + L + NP L Sbjct: 246 TREEMAAVRELARPNGRIVNPQGL 269 Lambda K H 0.316 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 174 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 275 Length adjustment: 25 Effective length of query: 251 Effective length of database: 250 Effective search space: 62750 Effective search space used: 62750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory