Align phosphopentomutase (EC 5.4.2.7) (characterized)
to candidate SMc04119 SMc04119 phosphopentomutase
Query= BRENDA::P0A6K6 (407 letters) >FitnessBrowser__Smeli:SMc04119 Length = 406 Score = 471 bits (1213), Expect = e-137 Identities = 233/408 (57%), Positives = 299/408 (73%), Gaps = 5/408 (1%) Query: 1 MKRAFIMVLDSFGIGATEDAERFGDVGADTLGHIAEACAKGEADNG--RKGPLNLPNLTR 58 M RAF+ VLDSFGIG DAE FGD+GADTLGHIAE CA G AD R+GPL+LPN++ Sbjct: 1 MARAFLFVLDSFGIGNAPDAEAFGDLGADTLGHIAEFCAAGAADRAGLREGPLHLPNMSA 60 Query: 59 LGLAKAHEGSTGFIPAGMDGNAEVIGAYAWAHEMSSGKDTPSGHWEIAGVPVLFEWGYFS 118 LGL A +TG +PAGM V G Y A E+S GKDTPSGHWEIAG PV F+WGYF Sbjct: 61 LGLMHAARLATGRLPAGMALPERVYGIYGAASEVSRGKDTPSGHWEIAGTPVTFDWGYFP 120 Query: 119 DHENSFPQELLDKLVERANLPGYLGNCHSSGTVILDQLGEEHMKTGKPIFYTSADSVFQI 178 ++FP EL++ + ++PG LGNCH+SGT I+ + GEEHM++GKPI YTS+DSVFQI Sbjct: 121 AEGDAFPPELVEAICREGDVPGILGNCHASGTDIIARHGEEHMRSGKPICYTSSDSVFQI 180 Query: 179 ACHEETFGLDKLYELCEIAREELTNGGYNIGRVIARPFIGDKAGNFQRTGNRHDLAVEPP 238 A HE+TFGL++L LCE+ R + + YNIGRVIARPF+G G+F RTGNR D +V PP Sbjct: 181 AAHEQTFGLERLLNLCEVVRRLVDD--YNIGRVIARPFVGSDPGSFTRTGNRRDYSVLPP 238 Query: 239 APTVLQKLVDEKHGQVVSVGKIADIYANCGITKKVKATGLDALFDATIKEMKEAGDNTIV 298 PTVL +L E V ++GKI DI+A+ G+T+ KA G ALFDA+++ ++EA D +V Sbjct: 239 EPTVLDRL-QEAGRTVHAIGKIGDIFAHQGVTRLTKANGNMALFDASLEAIEEAEDGALV 297 Query: 299 FTNFVDFDSSWGHRRDVAGYAAGLELFDRRLPELMSLLRDDDILILTADHGCDPTWTGTD 358 FTNFVDFD +GHRRDV+GYAA LE FD RLP+L L+ D++ILTADHGCDPTW GTD Sbjct: 298 FTNFVDFDMLYGHRRDVSGYAAALEAFDARLPDLDRRLKPGDMVILTADHGCDPTWRGTD 357 Query: 359 HTREHIPVLVYGPKVKPGSLGHRETFADIGQTLAKYFGTSDMEYGKAM 406 HTRE +PVL++GP ++ S G ++FA IG+T+A++ G +G+++ Sbjct: 358 HTRERVPVLMFGPTLRSRSFGIADSFAHIGETVARHLGIGVGPHGRSL 405 Lambda K H 0.318 0.138 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 633 Number of extensions: 35 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 407 Length of database: 406 Length adjustment: 31 Effective length of query: 376 Effective length of database: 375 Effective search space: 141000 Effective search space used: 141000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate SMc04119 SMc04119 (phosphopentomutase)
to HMM TIGR01696 (deoB: phosphopentomutase (EC 5.4.2.7))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01696.hmm # target sequence database: /tmp/gapView.29459.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01696 [M=381] Accession: TIGR01696 Description: deoB: phosphopentomutase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.4e-152 491.5 0.0 8.3e-152 491.4 0.0 1.0 1 lcl|FitnessBrowser__Smeli:SMc04119 SMc04119 phosphopentomutase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SMc04119 SMc04119 phosphopentomutase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 491.4 0.0 8.3e-152 8.3e-152 1 379 [. 3 402 .. 3 404 .. 0.97 Alignments for each domain: == domain 1 score: 491.4 bits; conditional E-value: 8.3e-152 TIGR01696 1 rvflivldsvGiGeaedaadfkdeGadtlghiaealdk............lnlpnleklGlgkiee......lag 57 r+fl+vlds+GiG+a+da+ f+d Gadtlghiae ++ l+lpn++ lGl ++ +ag lcl|FitnessBrowser__Smeli:SMc04119 3 RAFLFVLDSFGIGNAPDAEAFGDLGADTLGHIAEFCAAgaadraglregpLHLPNMSALGLMHAARlatgrlPAG 77 89**********************************999**********************9999989999999* PP TIGR01696 58 vdaveevlayyaklseassGkdtmtGhweiaGlnilkefkvfs...ngfpeelldkleeragrk.vlgnkpasGt 128 + e+v + y+ +se+s Gkdt++GhweiaG ++++++++f+ ++fp el++ + + + + +lgn++asGt lcl|FitnessBrowser__Smeli:SMc04119 78 MALPERVYGIYGAASEVSRGKDTPSGHWEIAGTPVTFDWGYFPaegDAFPPELVEAICREGDVPgILGNCHASGT 152 *******************************************99999***************99********** PP TIGR01696 129 vildelGeehmktGklivytsadsvlqiaaheevvpleelyelcekarellkdpkyliGriiarpfvGe.aGnfk 202 i+ + Geehm++Gk+i yts+dsv+qiaahe++++le+l +lce++r l+ d y+iGr+iarpfvG +G f+ lcl|FitnessBrowser__Smeli:SMc04119 153 DIIARHGEEHMRSGKPICYTSSDSVFQIAAHEQTFGLERLLNLCEVVRRLVDD--YNIGRVIARPFVGSdPGSFT 225 *************************************************9976..*************88***** PP TIGR01696 203 rtsnrhdyalkpfaktvldklkdekydvisiGkiadiydgeGitkkvrtksnmdgldkvikelkedftg.isfan 276 rt+nr dy++ p+++tvld+l++++ v +iGki di++ +G+t+ ++++nm+++d+ ++ ++e+ +g ++f+n lcl|FitnessBrowser__Smeli:SMc04119 226 RTGNRRDYSVLPPEPTVLDRLQEAGRTVHAIGKIGDIFAHQGVTRLTKANGNMALFDASLEAIEEAEDGaLVFTN 300 *********************************************************************9***** PP TIGR01696 277 lvdfdalyGhrrdkeGyaaaleefdarlpellsklreddlliltadhGndptatGtdhtreyipvlvyspkvkkg 351 +vdfd lyGhrrd++Gyaaale fdarlp+l +l+ d++iltadhG+dpt++Gtdhtre +pvl+++p ++ lcl|FitnessBrowser__Smeli:SMc04119 301 FVDFDMLYGHRRDVSGYAAALEAFDARLPDLDRRLKPGDMVILTADHGCDPTWRGTDHTRERVPVLMFGPTLRSR 375 ***********************************************************************9987 PP TIGR01696 352 qalesaetfadiGatladnfntskpeyG 379 +++ a++fa+iG+t+a ++++ +G lcl|FitnessBrowser__Smeli:SMc04119 376 -SFGIADSFAHIGETVARHLGIGVGPHG 402 .****************99987665555 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (381 nodes) Target sequences: 1 (406 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 7.70 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory