GapMind for catabolism of small carbon sources

 

Aligments for a candidate for deoC in Sinorhizobium meliloti 1021

Align deoxyribose-phosphate aldolase (EC 4.1.2.4) (characterized)
to candidate SM_b21300 SM_b21300 deoxyribose-phosphate aldolase

Query= BRENDA::Q9Y315
         (318 letters)



>lcl|FitnessBrowser__Smeli:SM_b21300 SM_b21300 deoxyribose-phosphate
           aldolase
          Length = 334

 Score =  369 bits (946), Expect = e-107
 Identities = 188/313 (60%), Positives = 238/313 (76%), Gaps = 2/313 (0%)

Query: 5   NRGTELDLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDT 64
           N G ELDLSW+   +VN  A  RR + +  RRTVKK+ QAAWLLKAVT IDLTTL+GDDT
Sbjct: 23  NDGVELDLSWVLDQRVNLSAAERRVQTLPGRRTVKKDAQAAWLLKAVTCIDLTTLNGDDT 82

Query: 65  SSNIQRLCYKAKYPIREDLLKALNMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVAS 124
           +  ++RLC KA+ P+R+D+L AL M D+GITT A+CVY   V  AV+AL+ +G  IPVA+
Sbjct: 83  AERVKRLCAKARQPVRQDILDALGMGDRGITTGAICVYHRFVSTAVEALEGSG--IPVAA 140

Query: 125 VAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQFRKACGE 184
           V+ GFPAG      +L EI+ +V DGA EID+VI R  VLTG W+ALYDE+R FR ACG+
Sbjct: 141 VSTGFPAGLVPHDVKLREIKASVADGAREIDIVITREHVLTGNWQALYDEMRDFRAACGD 200

Query: 185 AHLKTILATGELGTLTNVYKASMIAMMAGSDFIKTSTGKETVNATFPVAIVMLRAIRDFF 244
           AH+K ILATG+L TL NV +AS++ MMAG+DFIKTSTGKE VNAT  V + MLR IR + 
Sbjct: 201 AHVKAILATGDLKTLRNVARASLVCMMAGADFIKTSTGKEGVNATLLVTLAMLRMIRAYE 260

Query: 245 WKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQIYHH 304
            +TG K+G+KPAGGI  AKD L +  L+KEELG EWL+P+LFR+GAS+LL+DIERQ+ HH
Sbjct: 261 ERTGIKVGYKPAGGISVAKDVLNYQFLMKEELGREWLEPDLFRVGASSLLADIERQLEHH 320

Query: 305 VTGRYAAYHDLPM 317
           V+G Y+A +  P+
Sbjct: 321 VSGAYSALNRHPI 333


Lambda     K      H
   0.320    0.133    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 355
Number of extensions: 8
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 318
Length of database: 334
Length adjustment: 28
Effective length of query: 290
Effective length of database: 306
Effective search space:    88740
Effective search space used:    88740
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)

Align candidate SM_b21300 SM_b21300 (deoxyribose-phosphate aldolase)
to HMM TIGR00126 (deoC: deoxyribose-phosphate aldolase (EC 4.1.2.4))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00126.hmm
# target sequence database:        /tmp/gapView.5412.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00126  [M=211]
Accession:   TIGR00126
Description: deoC: deoxyribose-phosphate aldolase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                            -----------
    3.1e-46  143.5   0.9    1.3e-45  141.5   0.9    1.8  1  lcl|FitnessBrowser__Smeli:SM_b21300  SM_b21300 deoxyribose-phosphate 


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Smeli:SM_b21300  SM_b21300 deoxyribose-phosphate aldolase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  141.5   0.9   1.3e-45   1.3e-45       3     201 ..      69     292 ..      67     297 .. 0.91

  Alignments for each domain:
  == domain 1  score: 141.5 bits;  conditional E-value: 1.3e-45
                            TIGR00126   3 akliDhtalkadtteedietlcaeAkky................kfaavcvnpsyvslAkelLkgteveictv. 59 
                                           + iD+t+l+ d+t e +++lca+A ++                 + a+cv+ ++vs A+e L+g+ + +++v 
  lcl|FitnessBrowser__Smeli:SM_b21300  69 VTCIDLTTLNGDDTAERVKRLCAKARQPvrqdildalgmgdrgiTTGAICVYHRFVSTAVEALEGSGIPVAAVs 142
                                          578**********************9988888888888777776788*************************97 PP

                            TIGR00126  60 vgFPlGasttevkllEakeaieeGAdEvDvviniaalkdkneevviedikavveacakvllKvilEtalLtdee 133
                                          +gFP+G   ++vkl E k++++ GA E+D+vi    +  +n+++ +++++    ac+++++K+il t+ L+   
  lcl|FitnessBrowser__Smeli:SM_b21300 143 TGFPAGLVPHDVKLREIKASVADGAREIDIVITREHVLTGNWQALYDEMRDFRAACGDAHVKAILATGDLKTLR 216
                                          8*********************************************************************9876 PP

                            TIGR00126 134 kk.kAseisieagadfvKtstgfsakgAtvedvrlmkkvvgd.......evgvKasGGvrtaedalalieagae 199
                                           + +As +++ agadf+Ktstg+  ++At+     m ++++        +vg K++GG+  a+d+l++     e
  lcl|FitnessBrowser__Smeli:SM_b21300 217 NVaRASLVCMMAGADFIKTSTGKEGVNATLLVTLAMLRMIRAyeertgiKVGYKPAGGISVAKDVLNYQFLMKE 290
                                          655**************************987777777777778899999**************9998655555 PP

                            TIGR00126 200 ri 201
                                           +
  lcl|FitnessBrowser__Smeli:SM_b21300 291 EL 292
                                          55 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (211 nodes)
Target sequences:                          1  (334 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.02
# Mc/sec: 2.51
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory