Align ABC transporter for D-Maltose and D-Trehalose, permease component 2 (characterized)
to candidate SM_b20632 SM_b20632 sugar uptake ABC transporter permease
Query= reanno::Smeli:SMc03063 (380 letters) >FitnessBrowser__Smeli:SM_b20632 Length = 287 Score = 139 bits (349), Expect = 1e-37 Identities = 75/221 (33%), Positives = 127/221 (57%), Gaps = 10/221 (4%) Query: 161 AGIGRSFLNSLTVAVPSTVIPILIAAFAAYALAWMPFPGRAVLLAVVVGLLVVPLQMSLI 220 AGI + NSL V++ + V+ + ++ A Y + FP + L +++ L++P Q L Sbjct: 74 AGIWQHMFNSLIVSIGTVVLTVAVSVLAGYGFSRYRFPFKNALFVLIIATLMIPFQSILT 133 Query: 221 PLLQLYNGVGAFFGVSAKTYMGIWLAHTGFGLPLAIYLLRNYMAGLPREIMESARVDGAS 280 PL + A FG++ + +G+ L + LP +++++RN +P+EI E+AR+DGA Sbjct: 134 PLFIIL----ARFGLN-NSLVGLMLVYVTLQLPFSVFMMRNAFDAVPKEIEEAARIDGAR 188 Query: 281 DFDIFVKIILPLSFPALASFAIFQFLWTWNDLLVAIVFLGAGDD---KLVLTGRLVNLLG 337 D + V+++LPL P +A+ +IF FL WN+ A+V L + D+ +++T LG Sbjct: 189 DLKLLVRVLLPLVMPGIATVSIFAFLNAWNEFFAALVLLSSNDNYTLPVLMTAVRAGRLG 248 Query: 338 SRGGNWEILTASAFITIVVPLIVFFALQRYLVRGLLAGSVK 378 + NW + A + +V L VF LQRY +RGL+AG+VK Sbjct: 249 AI--NWGAVQAGVAVMVVPCLFVFLLLQRYYMRGLMAGAVK 287 Lambda K H 0.324 0.139 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 257 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 380 Length of database: 287 Length adjustment: 28 Effective length of query: 352 Effective length of database: 259 Effective search space: 91168 Effective search space used: 91168 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory