Align MalG, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate SMc01979 SMc01979 sugar transport system permease ABC transporter protein
Query= TCDB::Q8DT26 (278 letters) >FitnessBrowser__Smeli:SMc01979 Length = 277 Score = 144 bits (364), Expect = 2e-39 Identities = 95/281 (33%), Positives = 155/281 (55%), Gaps = 11/281 (3%) Query: 3 RKKQ--LQIGSIYALLILLSFIWLFPIIWVILTSFRGEGTAYVPYII--PKTWTLDNYIK 58 R KQ L I A+L ++F LFP+ W++ + Y I P +L+++ Sbjct: 2 RAKQAFLTIAHRLAVLAYIAFA-LFPLFWLLKVAVTPNDLLYSEGIRLWPSRASLEHFDF 60 Query: 59 LFTNSSFPFGRWFLNTLIVSTATCVLSTSITVAMAYSLSRIKFKHRNGFLKLALVLNMFP 118 + +S+FP +F N+LIVS +T V+ T + Y+LSR +F+ + + L L+ MFP Sbjct: 61 VLRHSAFPV--FFRNSLIVSGSTAVIVTILASLSGYALSRFRFRGKYWLVTLMLLTQMFP 118 Query: 119 GFMSMIAVYYILKALNLTQTLTSLVLVYSS-GAALTFYIAKGFFDTIPYSLDESAMIDGA 177 M + ++ IL L LT +LT LV+VY++ ++ + FFD IP L+E+AMIDGA Sbjct: 119 LVMLVAPIFKILSPLGLTNSLTGLVVVYTAFNVPFATFLMQSFFDGIPKDLEEAAMIDGA 178 Query: 178 TRKDIFLKITLPLSKPIIVYTALLAFIAPWIDFIFAQVILGDATSKYTVAIGLFSMLQAD 237 T+ F +I LPL+ P I T F A W + +F+ +++ ++ T +GL S + Sbjct: 179 TQFVAFRQIILPLTLPGIAATLGFVFTAAWSELLFSLMLI-SGNAQATFPVGLLSFVSKF 237 Query: 238 TINNWFMAFAAGSVLIAIPITILFIFMQKYYVEGITGGSVK 278 +++ F A VL IP + F+ +Q+Y V+G+T G+VK Sbjct: 238 SVD--FGQMMAAGVLALIPACLFFLLIQRYLVQGLTAGAVK 276 Lambda K H 0.330 0.142 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 277 Length adjustment: 25 Effective length of query: 253 Effective length of database: 252 Effective search space: 63756 Effective search space used: 63756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory