Align MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized)
to candidate SM_b21106 SM_b21106 sugar ABC transporter ATP-binding protein
Query= TCDB::Q00752 (377 letters) >FitnessBrowser__Smeli:SM_b21106 Length = 365 Score = 333 bits (854), Expect = 4e-96 Identities = 183/379 (48%), Positives = 246/379 (64%), Gaps = 19/379 (5%) Query: 1 MVELNLNHIYKKYPNSSHYSVEDFDLDIKNKEFIVFVGPSGCGKSTTLRMVAGLEDITKG 60 M + L + K+Y + V DL++K++EFI VGPSGCGKSTTLRM+AGLE+++ G Sbjct: 1 MAPVTLKKLVKRY--GALEVVHGIDLEVKDREFIALVGPSGCGKSTTLRMIAGLEEVSGG 58 Query: 61 ELKIDGEVVNDKAPKDRDIAMVFQNYALYPHMSVYDNMAFGLKLRHYSKEAIDKRVKEAA 120 ++I G VND P+ R+I+MVFQ+YALYPHM+V +NM F LK+ E I RV EAA Sbjct: 59 AIEIGGRKVNDLPPRARNISMVFQSYALYPHMTVAENMGFSLKIAGRPAEEIKTRVAEAA 118 Query: 121 QILGLTEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVSMRAEIAK 180 IL L LER+P+ LSGGQRQRVAMGRAIVR VFL DEPLSNLDAKLR +R EI K Sbjct: 119 AILDLAHLLERRPSQLSGGQRQRVAMGRAIVRQPDVFLFDEPLSNLDAKLRTQVRTEIKK 178 Query: 181 IHRRIGATTIYVTHDQTEAMTLADRIVIMSSTKNEDGSGTIGRVEQVGTPQELYNRPANK 240 +H R+ AT IYVTHDQ EAMTL+DRIVIM G +EQVGTP++++ RPA K Sbjct: 179 LHARMQATMIYVTHDQVEAMTLSDRIVIMRD----------GHIEQVGTPEDVFRRPATK 228 Query: 241 FVAGFIGSPAMNFFDVTIKDGHLVSKDGLTIAVTEGQLKMLESKGFKNKNLIFGIRPEDI 300 FVAGFIGSP MN + + DG L G T+ + + + L +G K + FG+RP+D+ Sbjct: 229 FVAGFIGSPPMNMEEAVLTDGKLAFASGATLPLPP-RFRSLVREGQK---VTFGLRPDDV 284 Query: 301 SSS---LLVQETYPDATVDAEVVVSELLGSETMLYLKLGQTEFAARVDARDFHEPGEKVS 357 S L + ++ V ++E LG+ET+++ + ++ +R+ PGE V Sbjct: 285 YPSGHGLHAGDADAVHEIELPVTITEPLGNETLVFTQFNGRDWVSRMLNPRPLRPGEAVP 344 Query: 358 LTFNVAKGHFFDAETEAAI 376 ++F++A+ H FD ET A+ Sbjct: 345 MSFDLARAHLFDGETGRAL 363 Lambda K H 0.318 0.135 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 369 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 365 Length adjustment: 30 Effective length of query: 347 Effective length of database: 335 Effective search space: 116245 Effective search space used: 116245 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory