Align ABC-type transporter, integral membrane subunit, component of Trehalose porter. Also binds sucrose (Boucher and Noll, 2011). Induced by glucose and trehalose. Directly regulated by trehalose-responsive regulator TreR (characterized)
to candidate SMc01979 SMc01979 sugar transport system permease ABC transporter protein
Query= TCDB::G4FGN6 (278 letters) >FitnessBrowser__Smeli:SMc01979 Length = 277 Score = 206 bits (523), Expect = 6e-58 Identities = 101/266 (37%), Positives = 169/266 (63%), Gaps = 2/266 (0%) Query: 13 IAVVLILIWCVFPLYWAFISSIKPDRDLFEKNPSLFPKRITFENYVKVFKERPFHINIKN 72 +AV+ + + +FPL+W ++ P+ L+ + L+P R + E++ V + F + +N Sbjct: 14 LAVLAYIAFALFPLFWLLKVAVTPNDLLYSEGIRLWPSRASLEHFDFVLRHSAFPVFFRN 73 Query: 73 SIIVAGITTVLALVVGSLAGYAIARLKFRGKVIVMSLILAVSMFPQVSILGSLFLILRGL 132 S+IV+G T V+ ++ SL+GYA++R +FRGK +++L+L MFP V ++ +F IL L Sbjct: 74 SLIVSGSTAVIVTILASLSGYALSRFRFRGKYWLVTLMLLTQMFPLVMLVAPIFKILSPL 133 Query: 133 KLINTYTGLIIPYTAMNLPLTVWVLQSFFRELPKEVEESAFIDGASKLRTLWSIVLPMSA 192 L N+ TGL++ YTA N+P +++QSFF +PK++EE+A IDGA++ I+LP++ Sbjct: 134 GLTNSLTGLVVVYTAFNVPFATFLMQSFFDGIPKDLEEAAMIDGATQFVAFRQIILPLTL 193 Query: 193 PGLVATGLLTFIAAWNEFLFALTFMQKPSLYTVPVAVALFKGASQYEIPWGQLMAAAVIV 252 PG+ AT F AAW+E LF+L + + T PV + F S++ + +GQ+MAA V+ Sbjct: 194 PGIAATLGFVFTAAWSELLFSLMLISGNAQATFPVGLLSF--VSKFSVDFGQMMAAGVLA 251 Query: 253 TLPLVILVLVFQNRIIAGLSAGAVKG 278 +P + L+ Q ++ GL+AGAVKG Sbjct: 252 LIPACLFFLLIQRYLVQGLTAGAVKG 277 Lambda K H 0.329 0.142 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 207 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 277 Length adjustment: 25 Effective length of query: 253 Effective length of database: 252 Effective search space: 63756 Effective search space used: 63756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory