Align TreV, component of Trehalose porter (characterized)
to candidate SM_b20630 SM_b20630 sugar uptake ABC transporter ATP-binding protein
Query= TCDB::Q97ZC0 (324 letters) >FitnessBrowser__Smeli:SM_b20630 Length = 361 Score = 258 bits (660), Expect = 1e-73 Identities = 149/350 (42%), Positives = 208/350 (59%), Gaps = 31/350 (8%) Query: 2 TVELIDIVKKYGKNIVINGITEKIETGEFFVILGPSGEGKSTLLKILAGIEKLDKGKIIA 61 +V L DI K YG VI+GI IE G+F V +GPSG GKSTLL+++AG+E++ +G+I Sbjct: 9 SVVLSDIRKSYGGLEVIHGIDLTIEEGDFVVFVGPSGCGKSTLLRMIAGLEEVSEGEIAI 68 Query: 62 DGADITDKPPEKRNVAMVFQNYALYPNMSVRDNIAFPLKMRGMKKEEIIERVEKAAKLLG 121 G D+TD P +R +AMVFQ+YALYP+MSV +N+ F LKM EI RV + + +L Sbjct: 69 KGRDVTDLDPSERGIAMVFQSYALYPHMSVSENLGFGLKMARTDPAEIARRVAQVSAILK 128 Query: 122 ISEILDKKVTQISGGQQQRVALARAIVRNPSYFLLDEPLSNLDARVRTTARGELKRIQKE 181 I +LD++ Q+SGGQ+QRVA+ RAIVR P FL DEPLSNLDA +R + R E+ R+ +E Sbjct: 129 IDHLLDRRPGQLSGGQRQRVAIGRAIVRKPDVFLFDEPLSNLDAELRVSMRIEIARLHRE 188 Query: 182 LKGTFIYVTHDQKEALSLADRIAILHKGKFEQVSDPKTLYEYPKTKWVAQFVGEFPMNFL 241 L T +YVTHDQ EA++LAD+I +L G+ EQ P+ +YE P +VA F+G MNFL Sbjct: 189 LGNTMVYVTHDQTEAMTLADQIVVLRDGRIEQAGSPRDVYEDPANMFVAGFIGSPRMNFL 248 Query: 242 P-----------GELMKEKAQE-----------IGFRPEWV---EVGKGNLSCMVESVEA 276 GE E A + +G RPE + E G ++ VE E Sbjct: 249 DAEWQGDGTIRVGETTLEAAIDGGSLKHGERLLLGIRPEHIAVAEPGPERIAAQVEFSEY 308 Query: 277 SGESRYLICNFKNNNITILSQE---FYDVGQEVRFEIIKYRK---YNDGR 320 G +RYL C ++ ++ Q + G+++ F + R+ DGR Sbjct: 309 LGGTRYLYCQLEDGQSLVVEQREGPNWQAGEKLSFAVPDDRRRFFAEDGR 358 Lambda K H 0.318 0.137 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 303 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 361 Length adjustment: 29 Effective length of query: 295 Effective length of database: 332 Effective search space: 97940 Effective search space used: 97940 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory