Align fumarylacetoacetate (FAA) hydrolase (EC 3.7.1.2) (characterized)
to candidate SMc03207 SMc03207 aromatic amino acid degradation protein
Query= reanno::psRCH2:GFF3447 (327 letters) >FitnessBrowser__Smeli:SMc03207 Length = 338 Score = 417 bits (1072), Expect = e-121 Identities = 220/339 (64%), Positives = 255/339 (75%), Gaps = 18/339 (5%) Query: 1 MKLATLNQG-RDGVLVVVSRDLAQAVKVPQIAATLQAALDDWNYCKPKLEAVYQRLNDGL 59 MKLATL RDG LVVVS+DL + +V IA TLQAALDDW + P+LE R+ +G+ Sbjct: 1 MKLATLKDSTRDGKLVVVSKDLTRCSEVGHIARTLQAALDDWAHAGPRLE----RVAEGI 56 Query: 60 EEGA---FAFDQTACHSPLPRAYHWADGSAYVNHVELVRKARGAEMPESFWHDPLMYQGG 116 E GA F + SPLPRA+ WADGSAYVNHVELVRKAR AEMP SFW DPL+YQGG Sbjct: 57 ETGAQPTMRFHEHDAASPLPRAFQWADGSAYVNHVELVRKARNAEMPASFWTDPLIYQGG 116 Query: 117 ADAFIPPHSPIRLADEAWGIDLEGELAVITDDVPMGATPAEAASHIQLLMLVNDVSLRNL 176 +D+F+ P PI +AD+AWGID+EGE AVI DDVPMGAT EA + I+L+MLVNDVSLR L Sbjct: 117 SDSFLGPRDPILMADDAWGIDMEGEAAVIVDDVPMGATLDEAKAAIRLVMLVNDVSLRGL 176 Query: 177 IPGELAKGFGFYQSKPSSSFSPVAVTPDELGETWRDGKVHRPLVSHINGELFGQPDAGTD 236 IPGELAKGFGFYQSKPSS+FSPVAVTP+ELGE W GK+H PL +NGE FG+ +AG D Sbjct: 177 IPGELAKGFGFYQSKPSSAFSPVAVTPEELGEAWDGGKLHLPLHVDLNGEPFGRANAGID 236 Query: 237 MTFNFPTLVAHAARTRPLGAGTIIGSGTVSN----------YDRSAGSSCLAEKRMLEVV 286 MTF+FP L+ HAARTRPL AGTIIGSGTVSN + AG SC+AE RM+E + Sbjct: 237 MTFDFPQLIVHAARTRPLSAGTIIGSGTVSNKLEGGPGRPVSEGGAGYSCIAELRMIETI 296 Query: 287 EHGEAKTPFLKFGDRVRIEMFDAAGQSIFGAIDQQVERY 325 E G KT FLKFGD VRIEM D G SIFGAI+Q+V +Y Sbjct: 297 EGGAPKTQFLKFGDVVRIEMKDRTGHSIFGAIEQKVGKY 335 Lambda K H 0.318 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 413 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 327 Length of database: 338 Length adjustment: 28 Effective length of query: 299 Effective length of database: 310 Effective search space: 92690 Effective search space used: 92690 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory