Align 2-methylbutanoyl-CoA dehydrogenase / butanoyl-CoA dehydrogenase / isobutyryl-CoA dehydrogenase (EC 1.3.8.1; EC 1.3.8.5) (characterized)
to candidate SM_b20753 SM_b20753 acyl-CoA dehydrogenase
Query= reanno::pseudo3_N2E3:AO353_25680 (375 letters) >FitnessBrowser__Smeli:SM_b20753 Length = 380 Score = 295 bits (756), Expect = 1e-84 Identities = 161/371 (43%), Positives = 236/371 (63%), Gaps = 3/371 (0%) Query: 4 TDEQLQISDAARQFAQERLKPFAAEWDREHRFPKEAIGEMAELGFFGMLVPEQWGGCDTG 63 ++EQ I A FA++ + P A +WD++ FP E + A LG G+ + + GG Sbjct: 6 SEEQEAIRTMALDFARDEIAPHAVDWDQQKHFPVETLRAAAALGMAGIYIRDDVGGTGLT 65 Query: 64 YLAYAMALEEIAAGDGACSTIMSVHNSVGCVPILKFGNDDQKERFLKPLASGAMLGAFAL 123 L AM +E +A G A ++ +S+HN + I ++G D+Q+ R L PL + +L ++ L Sbjct: 66 RLDAAMIIEALATGCPAIASFVSIHNMCAGM-IDRYGTDEQRRRLLPPLLTMDVLASYCL 124 Query: 124 TEPQAGSDASSLKTRARLNGDHYVLNGCKQFITSGQNAGVVIVFAVTDPSAGKRGISAFI 183 TEP +GSDA++LKTRA GD Y+L G KQFI+ +G+ IV A T G +GISAF+ Sbjct: 125 TEPGSGSDAAALKTRAVREGDAYLLTGQKQFISGAGESGLYIVMARTGEE-GPKGISAFV 183 Query: 184 VPTDSPGYKVARVEDKLGQHASDTCQILFEDVQVPVANRLGEEGEGYKIALANLEGGRVG 243 V D+PG E K+G HA T ++ ++V+V V NRLG EGEG++IA+A L+GGR+ Sbjct: 184 VEKDAPGLTFGANEKKMGWHAQPTRAVMLDNVRVSVENRLGAEGEGFRIAMAGLDGGRLS 243 Query: 244 IASQSVGMARAAFEAARDYARERESFGKPIIEHQAVAFRLADMATQIAVARQMVHYAAAL 303 IA+ S+G A++AF+ A Y +ER +FGK I E QA+ FRLADMAT + +AR + AA Sbjct: 244 IAAASLGGAQSAFDKALAYVQERRAFGKAIGEFQALQFRLADMATDLEIARTFLWRAACA 303 Query: 304 RDSGKPALVE-ASMAKLFASEMAEKVCSTALQTLGGYGYLSDFPLERIYRDVRVCQIYEG 362 D+ P + +MAK F ++ V + ALQ GGYGYL+D+ +E+I RD+RV QI EG Sbjct: 304 LDAADPEATKLCAMAKRFVTDRCFSVANDALQLHGGYGYLADYGVEKIVRDLRVHQILEG 363 Query: 363 TSDIQRMVISR 373 T++I R+++SR Sbjct: 364 TNEIMRLIVSR 374 Lambda K H 0.319 0.134 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 313 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 380 Length adjustment: 30 Effective length of query: 345 Effective length of database: 350 Effective search space: 120750 Effective search space used: 120750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory