Align isobutyryl-CoA dehydrogenase (EC 1.3.8.1) (characterized)
to candidate SMc01639 SMc01639 acyl-CoA dehydrogenase
Query= reanno::psRCH2:GFF2392 (383 letters) >FitnessBrowser__Smeli:SMc01639 Length = 386 Score = 246 bits (627), Expect = 1e-69 Identities = 144/381 (37%), Positives = 215/381 (56%), Gaps = 13/381 (3%) Query: 6 LSEDQRMIRDMARDFARREIAPHAQAWEKAGWIDDTLVAQMG----ELGLLGMVVPEEWG 61 L+E+Q+MI D R F EI PH E+ G + L ++ ELG PEE G Sbjct: 5 LTEEQQMIVDTVRTFVETEIYPHENEVERTGVVPRELGLEIARKCKELGFFACNFPEEVG 64 Query: 62 GSYIDYVAYALAVEEISAGDGATGALMSIHNSVGCGPVLNYGSQAQKDEWLTELASGRAI 121 G+ +D++ + L E+ G G+ G + G +L ++ Q++ +L G Sbjct: 65 GAGLDHLTFTLVEREL--GRGSMGLTVFFGRPSG---ILMACNEDQRERYLLPAVRGDKF 119 Query: 122 GCFALTEPQAGSEAHNLRTRAELVDGHWVLNGSKQFCSNAKRSKLAIVFAVTD----PEL 177 A+TEP AGS+ ++ A W++NG+K F S+A + IVF T P Sbjct: 120 DALAMTEPDAGSDVRGMKCFARPDGDDWIVNGTKHFISHADIADFVIVFIATGEEQTPRG 179 Query: 178 GKKGLSAFLVPTDTPGFAVERSEHKMGIRASDTCGVSLSDCRIPEANLLGERGKGLAIAL 237 KK ++ FLV TPGF + + + R C ++ DCR+P A +LGE KG IA Sbjct: 180 PKKKITCFLVDRGTPGFEIREGYNSVSHRGYKNCILTFDDCRLPSAQILGEVHKGFDIAN 239 Query: 238 SNLEGGRIGIGAQALGIARAAFEAALLYARERVQFGKPIAEHQSIANMLADMQTQLNAAR 297 L R+ + A ++G AR AF+ AL YA ER QFGKPI+ +Q ++ LADM T+++AA Sbjct: 240 DWLYATRLTVAATSVGRARRAFDYALSYAAERKQFGKPISANQGVSFKLADMITEIDAAD 299 Query: 298 LLILHAARLKSAGLPCLSEASQAKLFASEMAEKVCSQAVQIHGGYGYLEDYPVERYYRDA 357 LL L AA GLP E + AK+FA+EM +V +A+QI+GG G ++D P+ R++RDA Sbjct: 300 LLTLSAAWRLDQGLPSNREIASAKVFATEMLARVTDEAIQIYGGMGLMDDLPLARFWRDA 359 Query: 358 RITQIYEGSSEIQRLLIAREL 378 R+ +I++G+SEIQR +I+R+L Sbjct: 360 RVERIWDGTSEIQRHIISRDL 380 Lambda K H 0.318 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 336 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 386 Length adjustment: 30 Effective length of query: 353 Effective length of database: 356 Effective search space: 125668 Effective search space used: 125668 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory