Align 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 (characterized)
to candidate SM_b20668 SM_b20668 hypothetical protein
Query= SwissProt::P31937 (336 letters) >FitnessBrowser__Smeli:SM_b20668 Length = 301 Score = 154 bits (389), Expect = 3e-42 Identities = 94/292 (32%), Positives = 151/292 (51%), Gaps = 10/292 (3%) Query: 36 VASKTPVGFIGLGNMGNPMAKNLMKHGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEK 95 +ASK V +GLG+MG MA ++ G ++ YDV P A + F G + +P + Sbjct: 1 MASKIAV--LGLGSMGFGMACSMKSAGLDVLGYDVAPPAVERFVAEGGRGAGTPGEAVTG 58 Query: 96 ADRIITMLPTSINAIEAYSGANGILKKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFM 155 AD I++++ + G NG+ +K G+ I S+T+DPA++++LA+ +E +G ++ Sbjct: 59 ADIIVSIVVSGAQTEAVLFGPNGVAGAMKPGAAFISSATMDPAIARDLAQRLEALGLHYL 118 Query: 156 DAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMGSNVVYC-GAVGTGQAAKICNNM 214 DAP+SGG A G LT M G FAAA+ L M + V G GTG A K+ N + Sbjct: 119 DAPISGGAAKAAKGELTIMASGSPQAFAAARPALDAMAAKVYELGGTAGTGAAFKMINQL 178 Query: 215 LLAISMIGTAEAMNLGIRLGLDPKLLAKILNMSSGRCWSSDTYNPVPGVMDGVPSANNYQ 274 L + + EA+ + GLD + +++ S+G W + N +P V+ A +Y Sbjct: 179 LAGVHIAAACEAIAFAAKQGLDLDKVYEVITASAGNSWMFE--NRIPHVL-----AGDYA 231 Query: 275 GGFGTTLMAKDLGLAQDSATSTKSPILLGSLAHQIYRMMCAKGYSKKDFSSV 326 + KDLG+ QD A + + P+ L + A Q+Y G + D SS+ Sbjct: 232 PLSAIEIFVKDLGIVQDMARAERYPVPLVAAALQMYLAASGAGMGRDDDSSL 283 Lambda K H 0.318 0.133 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 265 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 301 Length adjustment: 27 Effective length of query: 309 Effective length of database: 274 Effective search space: 84666 Effective search space used: 84666 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory