Align 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31) (characterized)
to candidate SM_b20679 SM_b20679 tartronate semialdehyde reductase
Query= reanno::psRCH2:GFF2390 (296 letters) >FitnessBrowser__Smeli:SM_b20679 Length = 294 Score = 158 bits (399), Expect = 2e-43 Identities = 106/287 (36%), Positives = 145/287 (50%), Gaps = 8/287 (2%) Query: 3 IGFIGLGNMGAPMAHNLLKAGHQLSVFDLNAAAVENLVGAGALPVDSPTAIAQGNAELII 62 IGFIGLG MG PMA +L AGH++ + LV G V++P A+A+ + II Sbjct: 4 IGFIGLGIMGTPMARHLQDAGHEIITSKFVIPPRQELVENGLEIVETPKALAE-TVDTII 62 Query: 63 TMLPAAAHVKGVYLGVNGLIAHSRAGVMLIDCSTIDPHSAREVAKAAAEHGNPMLDAPVS 122 MLP VK V G NG+ G ++ID S+I P +E AK E G +DAPVS Sbjct: 63 LMLPDTPEVKDVLFGENGVYYGLGEGKLVIDMSSISPIETKEFAKKVRETGAEYIDAPVS 122 Query: 123 GGTGGAAAGTLTFMVGGSDPDFDHAQPILAAMGKNIVHCGAAGNGQVAKVANNMLLGISM 182 GG GA +L+ M GG F+ A P+ MGKNI G G+GQV KVAN +++ +++ Sbjct: 123 GGEVGAKNASLSIMAGGKPSSFERALPLFKLMGKNITLVGDCGDGQVTKVANQIIVALTI 182 Query: 183 IGVAEAMALGVALGMDAKTLAGVINTSSGRCWSSDTYNPFPGVLDNVPSSRGYSGGFGSD 242 V+EA+ G D A V G SS V + R + GF Sbjct: 183 EAVSEALVFASKAGADP---ARVREALMGGFASSRILE----VHGDRMIKRTFEPGFRIS 235 Query: 243 LMLKDLGLATEAAKQVRQPVILGALAQQLYQSFSAQGHGGLDFSAII 289 L KDL LA + AK + + A Q+L+ + +A G GLD S ++ Sbjct: 236 LHQKDLNLALQGAKSLGISLPNTAATQELFNNCAANGDSGLDHSGLV 282 Lambda K H 0.318 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 211 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 294 Length adjustment: 26 Effective length of query: 270 Effective length of database: 268 Effective search space: 72360 Effective search space used: 72360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory