Align 3-hydroxyisobutyrate dehydrogenase subunit (EC 1.1.1.31) (characterized)
to candidate SMa0516 SMa0516 hypothetical protein
Query= metacyc::MONOMER-11664 (295 letters) >FitnessBrowser__Smeli:SMa0516 Length = 295 Score = 153 bits (386), Expect = 5e-42 Identities = 95/291 (32%), Positives = 148/291 (50%), Gaps = 7/291 (2%) Query: 2 RIAFIGLGNMGAPMARNLIKAGHQLNLFDLNKTVLAELAELGGQISPSPKDAAANSELVI 61 R+A IG G MG + L++ G++L +FD + L + G +PS +AAA S+ VI Sbjct: 4 RVALIGAGAMGGSIGARLVETGNRLTVFDPGPDKVQALVDKGAFAAPSAAEAAAVSDYVI 63 Query: 62 TMLPAAAHVRSVYLNDDGVLAGIRPGTPTVDCSTIDPQTARDVSKAAAAKGVDMGDAPVS 121 L A A VR D GV AG + GT +D S+IDP + ++ AA KG+ D+P+S Sbjct: 64 LSLNAPAIVRQAVFGDAGVAAGAQAGTLIIDMSSIDPNATKQLAADAAEKGLRWVDSPLS 123 Query: 122 GGTGGAAAGTLTFMVGASAELFASLKPVLEQMGRNIVHCGEVGTGQIAKICNNLLLGISM 181 GG A G LT M G +A+ VL + N H G VG GQ K+ N +L G+ Sbjct: 124 GGAPKALIGELTLMAGGTAQDVKDAHAVLRHVASNYTHMGSVGAGQTTKLINQVLCGLGF 183 Query: 182 IGVSEAMALGNALGIDTKVLAGIINSSTGRCWSSDTYNPWPGIIETAPASRGYTGGFGAE 241 + V+EA L G+D + + GR S+ P + ++ Y + Sbjct: 184 LAVAEATQLALDAGVDASKIPQALMG--GRADSAILQEYMPRFV-----TKDYRHTGRID 236 Query: 242 LMLKDLGLATEAARQAHQPVILGAVAQQLYQAMSLRGEGGKDFSAIVEGYR 292 M+KDL A + AR+ + + L A ++++ ++ G GG+D +A++E +R Sbjct: 237 NMVKDLAGAQDLARRTNTAMPLTAACAEIHRMLTAAGLGGEDQAALMEFFR 287 Lambda K H 0.317 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 217 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 295 Length adjustment: 26 Effective length of query: 269 Effective length of database: 269 Effective search space: 72361 Effective search space used: 72361 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory