Align NatA, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate SMc01949 SMc01949 high-affinity branched-chain amino acid ABC transporter ATP-binding protein
Query= TCDB::Q7A2H0 (260 letters) >FitnessBrowser__Smeli:SMc01949 Length = 295 Score = 155 bits (391), Expect = 1e-42 Identities = 95/259 (36%), Positives = 145/259 (55%), Gaps = 9/259 (3%) Query: 10 PLLAASGLCKSFGGIKAVQEARIEVAQGSITGLIGPNGAGKTTLFNLLSNFIRPDKGRVI 69 P+L L FGG+ A+ + E +G IT LIGPNGAGKTT+FN ++ F +P G + Sbjct: 12 PILKVERLSMRFGGLMAINDFSFEAERGEITALIGPNGAGKTTVFNCITGFYKPTMGMIT 71 Query: 70 FDGEP-----IQQLQPHQIAQQGMV-RTFQVARTLSRLSVLENMLLAAQKQ--TGENFWQ 121 + +++L +I ++ V RTFQ R S L+VLEN+L+A + + Sbjct: 72 MRQKSGAEFLLERLPDFEITKKAKVARTFQNIRMFSGLTVLENLLVAQHNKLMRASGYTI 131 Query: 122 VQLQPQVVVKE-EKQLQEQAMFLLESVGLAKKAYEYAGGLSGGQRKLLEMGRALMTNPKL 180 + L +E ++ E A LE L ++A + AG L G ++ LE+ RA+ T P+L Sbjct: 132 LGLFGFPAYREASRESIELARHWLEKASLTERADDPAGDLPYGAQRRLEIARAMCTGPEL 191 Query: 181 ILLDEPAAGVNPRLIDDICDRILTWNRQDGMTFLIIEHNMDVIMSLCDRVWVLAEGQNLA 240 + LDEPAAG+NPR + + R G + L+IEH+M V+M + D V VL GQ ++ Sbjct: 192 LCLDEPAAGLNPRESLALNALLQEIRRDTGTSILLIEHDMSVVMEISDHVVVLEYGQKIS 251 Query: 241 DGTPAEIQTNSQVLEAYLG 259 DG P ++ + +V+ AYLG Sbjct: 252 DGNPDFVKNDPRVIAAYLG 270 Lambda K H 0.319 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 295 Length adjustment: 25 Effective length of query: 235 Effective length of database: 270 Effective search space: 63450 Effective search space used: 63450 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory