Align ABC transporter for Xylitol, permease component 2 (characterized)
to candidate SMc01498 SMc01498 sorbitol/mannitol transport inner membrane protein
Query= reanno::Dino:3607127 (272 letters) >FitnessBrowser__Smeli:SMc01498 Length = 276 Score = 185 bits (470), Expect = 8e-52 Identities = 95/273 (34%), Positives = 161/273 (58%), Gaps = 2/273 (0%) Query: 1 MTSTRSLFSQIALLVLIITVCVFPFYWMVTTSLKTQIVALEAPPVWIF-EPTLSNYREAL 59 +++ R L + + + I + FP W TS KT+ A+ +PPV++F + T NY E Sbjct: 5 VSTGRKLITTVVAWTIGILI-FFPILWTFLTSFKTEAQAIASPPVFLFFDWTTENYSEVQ 63 Query: 60 FEDGVLRTLINSLIIAISTTFLALVLGVPAAFALARFEFRGKKDLWFWFITNRMISPIVL 119 L+ +NS++++ +T L L++ +P+A+A+A + KD+ W ++ +M+ P+ + Sbjct: 64 SRSDYLKHFMNSVVVSFGSTLLGLLIAIPSAWAMAFSPTKRTKDVLMWMLSTKMMPPVGV 123 Query: 120 ALPFFLIARNLGLLDKHITLILIYLTFNLPIVIWIVTDQFRGIPYDLDEAARLEGASQFT 179 +P +LI RN GLLD L+++ NLPI+IW++ F+ IP ++ EAAR++GAS Sbjct: 124 LVPMYLIFRNWGLLDTRTGLVIVLTLINLPIIIWMLYTYFKEIPGEILEAARMDGASLTK 183 Query: 180 IMRKICLPLAMPGVAVSAIFSFIFSWNELMFGLILTRSEAKTAPAMAVSFMEGYNLPYGK 239 + + P+A+PG+A + + + I +WNE + L L+ ++A A S+ L Y K Sbjct: 184 EIIYVLTPMAIPGIASTLLLNIILAWNEAFWTLNLSAAKAAPLTAFIASYSSPEGLFYAK 243 Query: 240 IMATSTLIVIPVLIFALIASKQLVRGLTMGAVK 272 + A ST+ + P+LI + KQLVRGLT GAVK Sbjct: 244 LSAASTMAIAPILILGWFSQKQLVRGLTFGAVK 276 Lambda K H 0.331 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 261 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 276 Length adjustment: 25 Effective length of query: 247 Effective length of database: 251 Effective search space: 61997 Effective search space used: 61997 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory