Align ABC transporter for Xylitol, permease component 2 (characterized)
to candidate SMc01626 SMc01626 ABC transporter permease
Query= reanno::Dino:3607127 (272 letters) >FitnessBrowser__Smeli:SMc01626 Length = 285 Score = 189 bits (481), Expect = 4e-53 Identities = 100/269 (37%), Positives = 154/269 (57%), Gaps = 10/269 (3%) Query: 14 LVLIITVCVFPFYWMVTTSLKTQIVALEAPPVWIFEPTLSNYREAL----------FEDG 63 L L++ +FP W+ S +T L PP +F PTL NY + + Sbjct: 16 LTLVVVFFMFPIVWIFLMSFQTNETILRIPPSVVFTPTLENYAALITGKLQTASGTLDIA 75 Query: 64 VLRTLINSLIIAISTTFLALVLGVPAAFALARFEFRGKKDLWFWFITNRMISPIVLALPF 123 +R L NS+++++++ LALVLGVPAA+A AR +FRG +D+ F ++ R P+++ LP Sbjct: 76 FMRNLGNSVLLSVASVALALVLGVPAAYAFARHKFRGSEDIAFTLLSFRFAPPLLVLLPL 135 Query: 124 FLIARNLGLLDKHITLILIYLTFNLPIVIWIVTDQFRGIPYDLDEAARLEGASQFTIMRK 183 + LGL + + LI IY LP+++WIV F I D++ A R+ G S F+ RK Sbjct: 136 TQYFQWLGLSNTYFGLIWIYQLICLPLILWIVRGYFEDISADVEYAYRIAGHSWFSTFRK 195 Query: 184 ICLPLAMPGVAVSAIFSFIFSWNELMFGLILTRSEAKTAPAMAVSFMEGYNLPYGKIMAT 243 I LPLA PG+A + + +FIF+WN +F L+L ++ + A++F+ + YG+I A Sbjct: 196 IALPLAGPGIAAAGLLAFIFAWNNFVFALVLASADKQPVTVGALAFVTASGIQYGQIAAA 255 Query: 244 STLIVIPVLIFALIASKQLVRGLTMGAVK 272 L + P L AL A + LV GL++GAVK Sbjct: 256 IVLSITPTLALALYAQRYLVEGLSLGAVK 284 Lambda K H 0.331 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 285 Length adjustment: 25 Effective length of query: 247 Effective length of database: 260 Effective search space: 64220 Effective search space used: 64220 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory