Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate SMc01978 SMc01978 sugar transport system permease ABC transporter protein
Query= uniprot:D8IPH8 (292 letters) >FitnessBrowser__Smeli:SMc01978 Length = 311 Score = 123 bits (308), Expect = 6e-33 Identities = 88/287 (30%), Positives = 145/287 (50%), Gaps = 9/287 (3%) Query: 8 SLPYLFLGPSLLVMLVLGLVPTVAAINLALKNRVLRYPDSD-YVWLRNLERLMSDRRFLN 66 S PYL+ P+L++++ + LVP V I+ A ++ L P S +V L + L D+ F Sbjct: 25 SAPYLYTAPALILIVTVMLVPLVLGISYAFRDIQLLNPFSGGFVGLDHFRALAQDQAFFR 84 Query: 67 AIEVSAVWEVVTVLGAVIVGIAIAVYLFENVHGKWRQAMCVLLITPVLLPRVSAAFIWKF 126 ++ + W +V G+ +A+ L + HG R L+ P +P A W + Sbjct: 85 SLRNTLWWTGASVFLQFAFGLILALLLDKPFHG--RAIAQALVFLPWAVPSFLAGLNWAW 142 Query: 127 MYSPLTGILGWLLGLVGI--HDTAFLSDPALALYAVALVDIWQWGL-FFAVIVLKLLETL 183 +++P+ G L L +GI T LSDP LA++ + +IW WG+ FFA+ +L L+ + Sbjct: 143 LFNPVVGPLPHWLFALGIMSQPTNILSDPQLAMWGPIVANIW-WGIPFFAITLLAALQAI 201 Query: 184 PPEPLEAARLDYARTWQVYAYIALPMLKGPLISLVFIKMVESLRSFDLIYVMTKGGPGVA 243 P + EAA +D A Q + I LP L + + ++ V DLI VMT GGP Sbjct: 202 PRDLYEAASIDGAGPLQRFLSITLPFLAPTIAITILLRTVWISNFADLIIVMTNGGPADR 261 Query: 244 TETLDMYAYAQGIGLSGKVSYASTMAVLMMIATTLIFTLIWKRVSKW 290 T+ + Y + Q YAS +A L+++A L ++L+ + +W Sbjct: 262 TQIVASYIFTQAFKRL-DFGYASAIA-LVLLALLLAYSLLIVILRQW 306 Lambda K H 0.328 0.141 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 270 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 311 Length adjustment: 27 Effective length of query: 265 Effective length of database: 284 Effective search space: 75260 Effective search space used: 75260 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory