Align ABC-type sugar transport system, ATPase component protein (characterized, see rationale)
to candidate SM_b20235 SM_b20235 sugar ABC transporter ATP-binding protein
Query= uniprot:D8IPI1 (406 letters) >FitnessBrowser__Smeli:SM_b20235 Length = 363 Score = 314 bits (804), Expect = 3e-90 Identities = 171/360 (47%), Positives = 229/360 (63%), Gaps = 24/360 (6%) Query: 1 MADIHCQALAKHYAGGPPVLHPLDLHIGDGEFVVLLGPSGCGKSTMLRMIAGLEDISGGT 60 MA + + + K + G V+H + I DGEFV L+GPSGCGKST+LRMIAGLE+IS G Sbjct: 1 MASVEIRNVVKRF-GALEVVHGVSAEIADGEFVALVGPSGCGKSTLLRMIAGLEEISDGA 59 Query: 61 LRIGGTVVNDLPARERNVAMVFQNYALYPHMSVYDNIAFGLRRLKRPAAEIDRRVREVAA 120 + IGG +VN++ ++RN++MVFQNYALYPHM+V +N+AF LR + P E R+V E A Sbjct: 60 VVIGGDIVNEVAPKDRNISMVFQNYALYPHMTVAENMAFALRLARLPKDEQKRKVGEAAT 119 Query: 121 LLNLEALLERKPRAMSGGQQQRAAIARAIIKTPSVFLFDEPLSNLDAKLRAQLRGDIKRL 180 +L L LL+R P +SGGQ+QR A+ RAI++ P VFLFDEPLSNLDAKLR Q+R +IK L Sbjct: 120 MLGLGGLLDRYPGQLSGGQRQRVAMGRAIVRRPEVFLFDEPLSNLDAKLRVQMRAEIKGL 179 Query: 181 HQRLRTTTVYVTHDQLEAMTLADRVILMQDGRIVQAGSPAELYRYPRNLFAAGFIGTPAM 240 HQRLRTT++YVTHDQ+EAMT+ADR+++M+DG + Q G+P E++ YPRNLF A FIG+P+M Sbjct: 180 HQRLRTTSIYVTHDQIEAMTMADRIVVMRDGNVEQIGTPLEIFDYPRNLFVASFIGSPSM 239 Query: 241 NFLSGTVQ----RQDGQLFIETAHQRWALTGERFSRLRHAMAVKLAVRPDHVRIAGEREP 296 NF+ G V R G + I L H +RP+ ++I G P Sbjct: 240 NFIEGEVVGGTFRAPGGIIIPAPD------------LAHKGPTVAGIRPNKLQI-GATGP 286 Query: 297 AASLTCPVSVELVEILGADALLTTRCGDQTLTALVPADRLPQPGATLTLALDQHELHVFD 356 +A V +VE G + L G L L+ PG + LA ++H FD Sbjct: 287 SA------KVLIVEPTGDETHLLVELGGAQLAMLLRERTSLAPGDEIGLAFASADVHFFD 340 Lambda K H 0.321 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 437 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 363 Length adjustment: 30 Effective length of query: 376 Effective length of database: 333 Effective search space: 125208 Effective search space used: 125208 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory