Align ABC-type sugar transport system, ATPase component protein (characterized, see rationale)
to candidate SMc02474 SMc02474 ABC transporter ATP-binding protein
Query= uniprot:D8IPI1 (406 letters) >FitnessBrowser__Smeli:SMc02474 Length = 356 Score = 341 bits (874), Expect = 2e-98 Identities = 183/364 (50%), Positives = 244/364 (67%), Gaps = 9/364 (2%) Query: 1 MADIHCQALAKHYAGGPPVLHPLDLHIGDGEFVVLLGPSGCGKSTMLRMIAGLEDISGGT 60 MA + + + K YA V+H + L I +GEF+ L+GPSGCGKST+LRMIAGLE+IS G Sbjct: 1 MASVELRDIRKSYAA-LEVVHGVSLSIAEGEFIALVGPSGCGKSTLLRMIAGLEEISDGE 59 Query: 61 LRIGGTVVNDLPARERNVAMVFQNYALYPHMSVYDNIAFGLRRLKRPAAEIDRRVREVAA 120 + IGG VVN L RERN+AMVFQ+YALYPHMSV +N+ F L+ EID++V E A Sbjct: 60 VLIGGKVVNPLTPRERNIAMVFQSYALYPHMSVAENMGFNLKLSGLSRPEIDKKVGEAAR 119 Query: 121 LLNLEALLERKPRAMSGGQQQRAAIARAIIKTPSVFLFDEPLSNLDAKLRAQLRGDIKRL 180 +L L LL+RKP +SGGQ+QRAA+ RAI++ P+VFLFDEPLSNLDAKLR Q+R +IK L Sbjct: 120 MLALTELLDRKPSQLSGGQRQRAAMGRAIVRDPAVFLFDEPLSNLDAKLRVQMRTEIKAL 179 Query: 181 HQRLRTTTVYVTHDQLEAMTLADRVILMQDGRIVQAGSPAELYRYPRNLFAAGFIGTPAM 240 HQ++ TT++YVTHDQ+EAMTLADR++++ GRI Q G+P ELYR P NLF AGFIG+PAM Sbjct: 180 HQKVATTSIYVTHDQIEAMTLADRIVVLNGGRIEQVGTPLELYRTPANLFVAGFIGSPAM 239 Query: 241 NFLSGTVQRQDGQLFIETAH-QRWALTGERFSRLRHAMAVKLAVRPDHVRIAGEREPAAS 299 N L GTV DG+ + + ER ++R AV++ +RP+H GE A Sbjct: 240 NVLDGTVDADDGEPAVRLGDGSAIRIAPER--KVRPGQAVRIGLRPEHFVAGGEGNAIAG 297 Query: 300 LTCPVSVELVEILGADALLTTRCGDQTLTALVPADRLPQPGATLTLALDQHELHVFDVES 359 T LVE GA + + +TA+V D + G+ A+D+ +++VFD ++ Sbjct: 298 QTL-----LVEPTGAQTHVLFEFAGEQITAVVDGDHPARHGSLFRAAMDRSQVYVFDRQT 352 Query: 360 GENL 363 G L Sbjct: 353 GAAL 356 Lambda K H 0.321 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 425 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 356 Length adjustment: 30 Effective length of query: 376 Effective length of database: 326 Effective search space: 122576 Effective search space used: 122576 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory