GapMind for catabolism of small carbon sources

 

Aligments for a candidate for PS417_12065 in Sinorhizobium meliloti 1021

Align D-ribose transporter ATP-binding protein; SubName: Full=Putative xylitol transport system ATP-binding protein; SubName: Full=Sugar ABC transporter ATP-binding protein (characterized, see rationale)
to candidate SM_b21376 SM_b21376 sugar uptake ABC transporter ATP-binding protein

Query= uniprot:A0A1N7TX47
         (495 letters)



>lcl|FitnessBrowser__Smeli:SM_b21376 SM_b21376 sugar uptake ABC
           transporter ATP-binding protein
          Length = 503

 Score =  365 bits (936), Expect = e-105
 Identities = 208/497 (41%), Positives = 302/497 (60%), Gaps = 5/497 (1%)

Query: 2   ARPLLLQAEHVAKAYAGVPALRDGRLSLRAGSVHALCGGNGAGKSTFLSILMGITQRDAG 61
           A   +L+   V K++  V AL+  RL +R G VH L G NGAGKST + IL G+    +G
Sbjct: 5   AADTILKITDVTKSFGQVAALKGMRLEVRRGRVHTLLGENGAGKSTLMKILAGVHGATSG 64

Query: 62  SILLNGAPVQFNRPSEALAAGIAMITQELEPIPYMTVAENIWLGREPRRAGCIVDNKALN 121
            I+L+G   +   P EA + G+A++ QEL     +TVAENI   REPRR G I D KAL 
Sbjct: 65  EIVLDGQAYRPANPQEAASLGLAIVFQELSLCNNLTVAENILATREPRRFGFIND-KALV 123

Query: 122 RRTRELLDSLEFDVDATSPMHRLSVAQIQLVEIAKAFSHDCQVMIMDEPTSAIGEHEAQT 181
            +   ++  L   +D T  +  LS+AQ QLVEIAK  SHD +V+I+DEPTS++ + EA+ 
Sbjct: 124 AKAHRIVADLRLPIDVTEKVGNLSIAQRQLVEIAKGLSHDAKVVILDEPTSSLSDSEAEI 183

Query: 182 LFKAIRRLTAQGAGIVYVSHRLSELAQIADDYSIFRDGAFVESGRMADIDRDHLVRGIVG 241
           LF+ I RL  +GA I+Y+SHR+ E+ +++DD ++ RDG +V +    ++  + L+  +VG
Sbjct: 184 LFEIIGRLRQRGAAIIYISHRMEEIMRLSDDITVIRDGEYVSTHARDEVTIETLIALMVG 243

Query: 242 QELTRIDHKVGRECAANTC--LQVDNLSRAGEFHDISLQLRQGEILGIYGLMGSGRSEFL 299
           + +  I        AA+    L VD L+R GEF D+S  +R GEILG +GL+GSGRSE +
Sbjct: 244 RRMDEIYPPPVHHVAADRAPVLAVDRLTREGEFQDVSFDVRAGEILGFFGLVGSGRSEVM 303

Query: 300 NCIYGLTVADSGSVTLQGKPMPIGLPKATINAGMSLVTEDRKDSGLVLTGSILSNIALSA 359
           N ++G+  A +G+V L G+ +    P   I  G+  VTE+RK+ GLVL  S+  NI+++A
Sbjct: 304 NALFGMKSA-AGTVRLDGEVVRFRSPDQAIARGVGFVTENRKEEGLVLGHSVEWNISMAA 362

Query: 360 YKRLS-SWSLINARKETQLAEDMVKRLQIKTTSLELPVASMSGGNQQKVVLAKCLSTEPV 418
               +     I    E   A + V +L IKT SLE P  ++SGGNQQK+VLAK L T P 
Sbjct: 363 LADFAGGLGFIRNGAERAAASEQVGKLSIKTNSLETPAGALSGGNQQKIVLAKWLLTRPK 422

Query: 419 CLLCDEPTRGIDEGAKQEIYHLLDQFVRGGGAAIVVSSEAPELLHLSDRIAVFKGGRLVT 478
            L+ DEPTRG+D GAK EIY ++ +    G A +++SS+ PE+L +SDR+ V   G    
Sbjct: 423 VLILDEPTRGVDVGAKFEIYKIIRELAAEGTAILLISSDLPEVLGMSDRVVVMHEGAPGA 482

Query: 479 ISTDTALSQEALLRLAS 495
               +AL+ E ++  A+
Sbjct: 483 TLEGSALTPETIMAHAT 499


Lambda     K      H
   0.319    0.135    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 549
Number of extensions: 25
Number of successful extensions: 10
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 495
Length of database: 503
Length adjustment: 34
Effective length of query: 461
Effective length of database: 469
Effective search space:   216209
Effective search space used:   216209
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory