Align Lmo2664 protein (characterized, see rationale)
to candidate SM_b20853 SM_b20853 sugar-alcohol dehydrogenase
Query= uniprot:Q8Y413 (350 letters) >FitnessBrowser__Smeli:SM_b20853 Length = 339 Score = 200 bits (509), Expect = 4e-56 Identities = 117/350 (33%), Positives = 184/350 (52%), Gaps = 16/350 (4%) Query: 1 MRAAVLYENNVIKAEQIDEATCGKDQVRVEVKAVGICGSDIHKMQTRWKYPLPAVMGHEF 60 MRA VL+ I+ E + G +V + V +VG+CGSD+ +M + + +P + GHEF Sbjct: 1 MRAIVLHAPGDIRLETRPKPVAGPGEVLLRVASVGVCGSDLPRMLVKGAWKMPLITGHEF 60 Query: 61 AGVITEIGSEVTNVAMGDRVAGIPLEPCMECNYCKAGDFALCDNYRMVGSHFHGGFAENV 120 +G I +G V +G+ A PL PC +C CK G+F+ C +Y GS G +AE V Sbjct: 61 SGHIHALGENVEGWEIGELTAIAPLMPCNQCIECKTGNFSRCRDYDYFGSRRDGAYAEFV 120 Query: 121 VMKADNVISIGD-LDFEEGAMIEPLAVSMHGVL---GIQPRLGDTVIVFGIGTIGILVVQ 176 + +N+I +D AM +P ++++H + GI G T V G G IG+ +Q Sbjct: 121 AVPVENLIKTPQHVDPRAIAMTDPASIALHAIWKAGGI--TAGQTGAVVGCGPIGLFAIQ 178 Query: 177 CLLLAGVKDIIAVDISDKKLADAREFGCKYTI-NPKNEDLKERVFAYTNGLGADIALECA 235 + + G +IAVD++++KLA AR+ G I + D KER AD+ +E Sbjct: 179 WMRIMGTSRVIAVDVTEEKLALARQAGADLCILSADFADNKER---------ADLVIEAV 229 Query: 236 GSKITQEQCLLVTKKKGKVGFLGIAYADVLLHEEAFENIFRRELTLKGFWNSYSAPFPGE 295 G T +++ G V F+GI DV L F+ R+E++L G WNS+ APFPG Sbjct: 230 GIDSTINAAVMLAAPGGHVTFIGIPVPDVKLSNATFQRFLRQEVSLHGSWNSFGAPFPGP 289 Query: 296 EWRTSIEFVKQGRIKLKPLISHRYKLEETKEAFDMILSREHDYNKVMILP 345 +W T+++ G +K + +ISH L E F +++ ++KV+ P Sbjct: 290 QWTTTVQKFATGELKWEFMISHDLDLAELPGIFQRFAAKDLHFSKVLFRP 339 Lambda K H 0.321 0.139 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 302 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 350 Length of database: 339 Length adjustment: 29 Effective length of query: 321 Effective length of database: 310 Effective search space: 99510 Effective search space used: 99510 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory