Align Lmo2663 protein (characterized, see rationale)
to candidate SMc01214 SMc01214 zinc-containing alcohol dehydrogenase
Query= uniprot:Q8Y414 (343 letters) >FitnessBrowser__Smeli:SMc01214 Length = 347 Score = 187 bits (475), Expect = 3e-52 Identities = 123/344 (35%), Positives = 180/344 (52%), Gaps = 10/344 (2%) Query: 1 MKAVVKTNPGYDQMELKDVEEPQVYGDKVKIKVAFTGICGSDIHTFKGEYKNPTTPVTLG 60 MKAV + G + +++V P+ D + +KV GICG+D H GE+ + T PVTLG Sbjct: 1 MKAVRLESVG--NISVRNVGIPEPGPDDLLVKVEACGICGTDRHLLHGEFPS-TPPVTLG 57 Query: 61 HEFSGVVVEVGPDVTSIKVGDRVTSETTFETCGECIYCKEHDYNLCSNRRGIGTQANGSF 120 HEF G+VVE G V I G R+T + +CG C C+ NLC N R IG +G F Sbjct: 58 HEFCGIVVEAGSAVRDIAPGARITGDPNI-SCGRCPQCQAGRVNLCRNLRAIGIHRDGGF 116 Query: 121 AEFVLSREESCHVLDERISLEAAALTEPLACCVHSALEKTTIRPDDTVLVFGPGPIGLLL 180 AE+VL + + + A EPLACC+H ++ + I+ TV + G G IGLL Sbjct: 117 AEYVLVPRKQAFEIPLTLDPVHGAFCEPLACCLH-GVDLSGIKAGSTVAILGGGVIGLLT 175 Query: 181 AQVVKAQGATVIMAGITKDSDRLRLAKELGMDRIVDTLKEDLAEVVLGMTG--GYGAERV 238 Q+ + GAT ++ T+ + + RLA+E+G VD D+ E + G G G + V Sbjct: 176 VQLARLAGATTVILS-TRQATKRRLAEEVGATATVDPSAGDVVEAIAGPVGLVPGGVDVV 234 Query: 239 FDCSGAVPAVNQGLPLTKKKGDFVQVGLFAE-KKNAIDEESIIQREIAYIGSRSQKPSSW 297 +C+G V Q L K G V +G+ + +K I+ I+ RE+ +GS P Sbjct: 235 IECAGVAETVKQSTRLAKAGGTVVILGVLPQGEKVEIEPFDILFRELRVLGS-FINPFVH 293 Query: 298 ILALDLLANGKIDTDKMITKVYGLDDWREAFEAVMAGNEIKVLV 341 A DL+A G I+ D+MI++ LD+ + A E+KVLV Sbjct: 294 RRAADLVATGAIEIDRMISRRISLDEAPDVISNPAAAGEVKVLV 337 Lambda K H 0.317 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 324 Number of extensions: 22 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 343 Length of database: 347 Length adjustment: 29 Effective length of query: 314 Effective length of database: 318 Effective search space: 99852 Effective search space used: 99852 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory