Align Xylulose kinase (EC 2.7.1.17) (characterized)
to candidate SMc02341 SMc02341 sugar kinase
Query= reanno::Dino:3608604 (480 letters) >FitnessBrowser__Smeli:SMc02341 Length = 477 Score = 252 bits (644), Expect = 2e-71 Identities = 173/484 (35%), Positives = 238/484 (49%), Gaps = 17/484 (3%) Query: 1 MYLGLDLGTSGLKAVLIDENQALVAEATAPLEVARPHPGWSEQMPCDWLAATEAAMAAL- 59 MYLG+DLGT +KA+LID + VAEA V+ P PG++E P DW A T AA+ A Sbjct: 1 MYLGIDLGTGSVKALLIDGDGKAVAEAARAYPVSSPMPGYAETSPADWWAQTVAAVRACC 60 Query: 60 -GARADLSGVRAIGLSGQMHGATLLDASHEVLRPCILWNDTRAAAEAAALDADP-AFRSV 117 G D VR IGLSGQ HG + A + LRP ILW D RA AE A+ A P A R Sbjct: 61 DGHGGD---VRGIGLSGQAHGLVAVGADAKPLRPAILWADQRATAEMEAVLALPEAVRRP 117 Query: 118 TGNIVFPGFTAPKLAWVRAHEPDVFDRTALVLLPKDYLRLWLTGEAVAEMSDAAGTSWLD 177 N V G L W+R +EP + +L PKD+LRL +TGEA E SDA+ T D Sbjct: 118 LANPVVSGMAGLSLLWLRRNEPATYAAIRRILAPKDWLRLVMTGEAATEPSDASMTLLYD 177 Query: 178 TGARDWSAPLLAATGLSRDHMPRLVEGSEVSGTLRDSLADAWGLPRGVPVAGGGGDNAAS 237 GA W+ +L++ + + +VE ++G L + A GL G PVA G D A+ Sbjct: 178 VGAGRWATDVLSSLSIDPAILAPIVESHSIAGRLSAAAAAELGLAAGTPVAAGLSDTASC 237 Query: 238 GIGMGVVRAGDGFVSLGTSGVLFAACDAYAPDPATAVHTFCHALPETWHQMGVILAATDA 297 GMG + G + +G+ + + ++ P +++ + + M + Sbjct: 238 LFGMGQTKPGSTILQVGSGIQIMSVVESIEPRVQPFYNSY-RGIGGNLYSMAALQNGGTV 296 Query: 298 LNWFARTCGTDAATL-TGGLGPLQAPGRPVFLPYLGGERTPHNDAAIRGAFARIDHAADR 356 W G A + G + G +FLPY+ GER P D A+A + R Sbjct: 297 FEWARTVLGASWAEMYRSGFEENEGNGGVIFLPYVTGERAPLLDPNASAAWANMRLGCTR 356 Query: 357 DALARAVLEGVAFAFRDSFDALAATGTRLERLVAVGGGAKSDTWVRMIATLIGLPIDLPQ 416 L R+V EGVA A RDS+DAL G +R++ GGG+ W +M+A ++ +P L Sbjct: 357 GQLIRSVFEGVALAVRDSWDALRGVGVSADRILLTGGGSTDPRWQQMLADILEVP--LVP 414 Query: 417 AGDYGGA-FGAARLGMMAATGQGAALATRP---PIARSLDPVPALADAFGEAHATYRATY 472 A D G A GAA LG MAA G + P + R ++P P +RATY Sbjct: 415 AHDLGNATIGAAYLGGMAA-GHWRCIEAIPFPDDLGRPIEPRP--FQGLDALLPRFRATY 471 Query: 473 TALK 476 LK Sbjct: 472 RGLK 475 Lambda K H 0.320 0.135 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 642 Number of extensions: 39 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 480 Length of database: 477 Length adjustment: 34 Effective length of query: 446 Effective length of database: 443 Effective search space: 197578 Effective search space used: 197578 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory