GapMind for catabolism of small carbon sources

 

Aligments for a candidate for xylB in Sinorhizobium meliloti 1021

Align Xylulose kinase (EC 2.7.1.17) (characterized)
to candidate SMc03164 SMc03164 xylulose kinase

Query= reanno::Smeli:SMc03164
         (484 letters)



>lcl|FitnessBrowser__Smeli:SMc03164 SMc03164 xylulose kinase
          Length = 484

 Score =  968 bits (2503), Expect = 0.0
 Identities = 484/484 (100%), Positives = 484/484 (100%)

Query: 1   MYLGLDLGTSGVKAMLMDGEQRIIGSASGALDVDRPHPGWSEQDPADWIRAAEEAIARLR 60
           MYLGLDLGTSGVKAMLMDGEQRIIGSASGALDVDRPHPGWSEQDPADWIRAAEEAIARLR
Sbjct: 1   MYLGLDLGTSGVKAMLMDGEQRIIGSASGALDVDRPHPGWSEQDPADWIRAAEEAIARLR 60

Query: 61  ETHAQALAAVRGIGLSGQMHGATLLDEGDAVLRPCILWNDTRSFREAAALDGDPQFRALT 120
           ETHAQALAAVRGIGLSGQMHGATLLDEGDAVLRPCILWNDTRSFREAAALDGDPQFRALT
Sbjct: 61  ETHAQALAAVRGIGLSGQMHGATLLDEGDAVLRPCILWNDTRSFREAAALDGDPQFRALT 120

Query: 121 GNIVFPGFTAPKLAWVRENEPEIFARVRWVLLPKDYLRLWLTGEHMSEMSDSAGTSWLDT 180
           GNIVFPGFTAPKLAWVRENEPEIFARVRWVLLPKDYLRLWLTGEHMSEMSDSAGTSWLDT
Sbjct: 121 GNIVFPGFTAPKLAWVRENEPEIFARVRWVLLPKDYLRLWLTGEHMSEMSDSAGTSWLDT 180

Query: 181 GKRKWSASLLAATHLEERQMPDLVEGTDAAGTLRPELAARWGMGPGVVVAGGAGDNAASA 240
           GKRKWSASLLAATHLEERQMPDLVEGTDAAGTLRPELAARWGMGPGVVVAGGAGDNAASA
Sbjct: 181 GKRKWSASLLAATHLEERQMPDLVEGTDAAGTLRPELAARWGMGPGVVVAGGAGDNAASA 240

Query: 241 CGMGTVGEGQAFVSLGTSGVLFAANASYLPNPESAVHAFCHALPNTWHQMGVILSATDAL 300
           CGMGTVGEGQAFVSLGTSGVLFAANASYLPNPESAVHAFCHALPNTWHQMGVILSATDAL
Sbjct: 241 CGMGTVGEGQAFVSLGTSGVLFAANASYLPNPESAVHAFCHALPNTWHQMGVILSATDAL 300

Query: 301 NWHSGVTGRSAAELTSELGESLKAPGSVTFLPYLSGERTPHNDATIRGVFAGLGHESSRA 360
           NWHSGVTGRSAAELTSELGESLKAPGSVTFLPYLSGERTPHNDATIRGVFAGLGHESSRA
Sbjct: 301 NWHSGVTGRSAAELTSELGESLKAPGSVTFLPYLSGERTPHNDATIRGVFAGLGHESSRA 360

Query: 361 VLTQAVLEGVSFAIRDSLEALRAAGTKLKRVTAIGGGSRSRYWLSSIATALNLPVDLPAD 420
           VLTQAVLEGVSFAIRDSLEALRAAGTKLKRVTAIGGGSRSRYWLSSIATALNLPVDLPAD
Sbjct: 361 VLTQAVLEGVSFAIRDSLEALRAAGTKLKRVTAIGGGSRSRYWLSSIATALNLPVDLPAD 420

Query: 421 GDFGAAFGAARLGLIAATGADPAAVCTAPETAETIAPEASLVPAYEDAYQRYRRLYPAIK 480
           GDFGAAFGAARLGLIAATGADPAAVCTAPETAETIAPEASLVPAYEDAYQRYRRLYPAIK
Sbjct: 421 GDFGAAFGAARLGLIAATGADPAAVCTAPETAETIAPEASLVPAYEDAYQRYRRLYPAIK 480

Query: 481 EAAL 484
           EAAL
Sbjct: 481 EAAL 484


Lambda     K      H
   0.317    0.132    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 924
Number of extensions: 30
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 484
Length of database: 484
Length adjustment: 34
Effective length of query: 450
Effective length of database: 450
Effective search space:   202500
Effective search space used:   202500
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

Align candidate SMc03164 SMc03164 (xylulose kinase)
to HMM TIGR01312 (xylB: xylulokinase (EC 2.7.1.17))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01312.hmm
# target sequence database:        /tmp/gapView.19249.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01312  [M=481]
Accession:   TIGR01312
Description: XylB: xylulokinase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                           -----------
   8.4e-182  590.9   0.0   9.5e-182  590.7   0.0    1.0  1  lcl|FitnessBrowser__Smeli:SMc03164  SMc03164 xylulose kinase


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Smeli:SMc03164  SMc03164 xylulose kinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  590.7   0.0  9.5e-182  9.5e-182       1     480 [.       3     476 ..       3     477 .. 0.97

  Alignments for each domain:
  == domain 1  score: 590.7 bits;  conditional E-value: 9.5e-182
                           TIGR01312   1 lGiDlgTssvKallvdekgeviasgsasltvispkpgwsEqdpeewlealeealkellekakeekkeikaisisG 75 
                                         lG+DlgTs+vKa+l+d ++++i+s+s +l+v +p+pgwsEqdp +w++a eea+++l+e++++  +++++i++sG
  lcl|FitnessBrowser__Smeli:SMc03164   3 LGLDLGTSGVKAMLMDGEQRIIGSASGALDVDRPHPGWSEQDPADWIRAAEEAIARLRETHAQALAAVRGIGLSG 77 
                                         7************************************************************************** PP

                           TIGR01312  76 QmHglvlLDeegkvlrpaiLWnDtrtaeeceeleeelgeeelleltgnlalegfTapKllWvrkhepevfariak 150
                                         QmHg++lLDe + vlrp+iLWnDtr+ +e++ l+ +    ++++ltgn++++gfTapKl+Wvr++epe+far++ 
  lcl|FitnessBrowser__Smeli:SMc03164  78 QMHGATLLDEGDAVLRPCILWNDTRSFREAAALDGDP---QFRALTGNIVFPGFTAPKLAWVRENEPEIFARVRW 149
                                         *******************************998655...8********************************** PP

                           TIGR01312 151 vlLPkDylrykLtgevvteysDAsGTllfdvkkrewskellkaldleesllPklvessekaGkvreevakklGle 225
                                         vlLPkDylr++Ltge+++e+sD++GT ++d+ kr+ws++ll+a++lee+++P lve+++ aG++r+e+a+++G+ 
  lcl|FitnessBrowser__Smeli:SMc03164 150 VLLPKDYLRLWLTGEHMSEMSDSAGTSWLDTGKRKWSASLLAATHLEERQMPDLVEGTDAAGTLRPELAARWGMG 224
                                         *************************************************************************** PP

                           TIGR01312 226 egvkvaaGggdnaagAiGlgivkegkvlvslGtSGvvlavedkaesdpegavhsFchalpgkwyplgvtlsatsa 300
                                          gv va+G+gdnaa+A+G+g+v eg+++vslGtSGv++a++ ++ ++pe+avh+Fchalp++w+++gv+lsat+a
  lcl|FitnessBrowser__Smeli:SMc03164 225 PGVVVAGGAGDNAASACGMGTVGEGQAFVSLGTSGVLFAANASYLPNPESAVHAFCHALPNTWHQMGVILSATDA 299
                                         *************************************************************************** PP

                           TIGR01312 301 lewlkellgeldveelneeaekvevgaegvlllPylsGERtPhldpqargsliGltanttradlarAvlegvafa 375
                                         l+w + ++g++  e + e+ e  ++   +v++lPylsGERtPh+d+++rg+++Gl ++++ra l++Avlegv+fa
  lcl|FitnessBrowser__Smeli:SMc03164 300 LNWHSGVTGRSAAELTSELGESLKA-PGSVTFLPYLSGERTPHNDATIRGVFAGLGHESSRAVLTQAVLEGVSFA 373
                                         *********6666555555555555.59*********************************************** PP

                           TIGR01312 376 lrdsldilkelkglkikeirliGGGaksevwrqiladilglevvvpe.eeegaalGaAilAaialgekdlveecs 449
                                         +rdsl++l++ +g+k+k++++iGGG++s++w+  +a+ l+l+v+ p+  + gaa+GaA+l++ia++ +d +++c+
  lcl|FitnessBrowser__Smeli:SMc03164 374 IRDSLEALRA-AGTKLKRVTAIGGGSRSRYWLSSIATALNLPVDLPAdGDFGAAFGAARLGLIAATGADPAAVCT 447
                                         **********.67*********************************999************************** PP

                           TIGR01312 450 eavvkqkesvepiaenveayeelyerykkly 480
                                         +  ++++    p+a+ v aye++y+ry++ly
  lcl|FitnessBrowser__Smeli:SMc03164 448 APETAETIA--PEASLVPAYEDAYQRYRRLY 476
                                         999888877..******************98 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (481 nodes)
Target sequences:                          1  (484 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.03
# Mc/sec: 7.59
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory