Align FAA hydrolase family protein (characterized, see rationale)
to candidate SMc04240 SMc04240 hypothetical protein
Query= uniprot:A0A2E7P912 (281 letters) >FitnessBrowser__Smeli:SMc04240 Length = 228 Score = 109 bits (273), Expect = 5e-29 Identities = 73/217 (33%), Positives = 105/217 (48%), Gaps = 14/217 (6%) Query: 61 PRIGACVG-NIGKFICIGLNYADHAAE-SNLPIPAEPVVFNKWTSAVVGPNDDVKIPRGS 118 P G+ VG + + C+G NYA HA E + P P F K ++ P ++ P S Sbjct: 14 PISGSSVGFPVRRVYCVGRNYAAHAREMGHDPDREAPFFFQKNADNLLPPGENFPYPTRS 73 Query: 119 KKTDWEVELGVVIGKGGSYIDEKDAMSHVAGYCVVNDVSEREYQIER---GGTWDKGKGC 175 EVEL V + GG+ I +A H+ GY V D + R+ Q E G W K Sbjct: 74 SDVHHEVELVVAMRTGGADIPVSEAADHIFGYGVGIDFTRRDLQAEAKKAGKPWTAAKAF 133 Query: 176 DTFGPIGPWLVTRDEVADPQKLGMWLEVDGKRYQNGNTSTMIFGVAHIVSYLSRFMSLQP 235 + P+ +V + P +WL+V+G+ Q G+ MI+ V I++ LSR +L P Sbjct: 134 EHSAPVSA-IVPVTAIGHPASGNIWLKVNGELRQQGDLDQMIWKVPEIIAELSRLFTLAP 192 Query: 236 GDVISTGTPPGVGMGVKPEAVYLRAGQTMRLGIDGLG 272 GD+I TGTP GVG + G + GIDG+G Sbjct: 193 GDIIMTGTPSGVGP--------VTQGDVVACGIDGIG 221 Lambda K H 0.316 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 178 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 228 Length adjustment: 24 Effective length of query: 257 Effective length of database: 204 Effective search space: 52428 Effective search space used: 52428 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory