GapMind for catabolism of small carbon sources

 

Aligments for a candidate for xad in Sinorhizobium meliloti 1021

Align Xylonate dehydratase (EC 4.2.1.82) (characterized)
to candidate SM_b20890 SM_b20890 dihydroxy-acid dehydratase

Query= reanno::pseudo5_N2C3_1:AO356_28760
         (594 letters)



>lcl|FitnessBrowser__Smeli:SM_b20890 SM_b20890 dihydroxy-acid
           dehydratase
          Length = 579

 Score =  478 bits (1229), Expect = e-139
 Identities = 261/571 (45%), Positives = 356/571 (62%), Gaps = 17/571 (2%)

Query: 7   RRLRSEQWFNDPAHADMTALYVERYM-NYGMTREELQSGRPIIGIAQTGSDLTPCNRHHL 65
           R+LRS++WF         A+    +M N G+  +    GRPIIGI  T S+LTPCN H  
Sbjct: 9   RKLRSQEWFGGTGK---NAIMHRSWMKNQGLPADTFD-GRPIIGICNTWSELTPCNAHLR 64

Query: 66  ELAQRVKAGIRDAGGIPMEFPVHPIAEQSRRPTAALDRNLAYLGLVEILHGYPLDGVVLT 125
           +LA+RVK G+ +AGG P+EFPV    E + RPTA + RNLA + + E + G P+DGVVL 
Sbjct: 65  DLAERVKRGVYEAGGFPVEFPVFSTGESTLRPTAMMFRNLAAMDVEESIRGNPVDGVVLL 124

Query: 126 TGCDKTTPACLMAAATTDLPAIVLSGGPMLDGHHKGELIGSGTVLWHARNLMAAGEIDYE 185
            GCDKTTP+ LM AA+ D+PAIV+SGGPML+G  +G+ +GSGT +W    ++ +GE+  E
Sbjct: 125 GGCDKTTPSLLMGAASVDIPAIVVSGGPMLNGKWRGKDVGSGTAIWQFSEMVKSGEMSLE 184

Query: 186 GFMEMTTAASPSVGHCNTMGTALSMNALAEALGMSLPGCASIPAPYRERGQMAYATGKRI 245
            FM+     + S G C TMGTA +M ++AEALGM+L G A+IPA    R  ++  TG+RI
Sbjct: 185 EFMDAEQGMARSAGSCMTMGTASTMASMAEALGMTLSGNAAIPAVDARRRVISQLTGRRI 244

Query: 246 CELVLQDIRPSQIMTRQAFENAIAVASALGASSNCPPHLIAIARHMGVELSLDDWQRIGE 305
            E+V +D++PS I+T++AFENAI V  A+G S+N   HL+A+A  +GV+LSLDDW R+G 
Sbjct: 245 VEMVKEDLKPSDILTKEAFENAIRVNGAVGGSTNAVLHLLALAGRVGVDLSLDDWDRLGR 304

Query: 306 DVPLLVNCMPAGKYLGEGFHRAGGVPSVMHELQKAGRLHEDCATVSGRTIGEIVSSSLTS 365
           DVP +VN  P+GKYL E F+ AGG+P V+  + + G LH D  TVSG TI   V   +  
Sbjct: 305 DVPTIVNLQPSGKYLMEEFYYAGGLPVVIKAVAEMGLLHNDAITVSGDTIWNDVKGVVNY 364

Query: 366 NADVIHPFDTPLKHRAGFIVLSGNFFD-SAIMKMSVVGEAFRKTYLSEPGAENSFEARAI 424
           N DVI P +  L    G  VL GN     A++K S       +            + RA+
Sbjct: 365 NEDVILPREKALTKSGGIAVLRGNLAPRGAVLKPSAASPHLMQ-----------HKGRAV 413

Query: 425 VFEGPEDYHARIDDPALDIDERCILVIRGVGTVGYPGSAEVVNMAPPAALIKQGIDSLPC 484
           VFE  EDYHARI+   LDIDE CI+V++  G  GYPG AEV NM  P  ++K+GI  +  
Sbjct: 414 VFESIEDYHARINREDLDIDETCIMVLKYCGPKGYPGMAEVGNMGLPPKVLKKGITDMIR 473

Query: 485 LGDGRQSGTSASPSILNMSPEAAVGGGLALLQTNDRLKVDLNTRTVNLLIDDEEMARRRL 544
           + D R SGT+    IL+ +PEAA GG LAL++  D ++VD+  RT++L + DEE+ARRR 
Sbjct: 474 ISDARMSGTAYGTVILHTAPEAAEGGPLALVENGDLIEVDIPNRTLHLHVSDEELARRRA 533

Query: 545 EWTPNIPPSQTPWQELYRQLVGQLSTGGCLE 575
            W   + P    +  LY + V Q   G  L+
Sbjct: 534 AWVSPVKPLTGGYGGLYIKTVMQADAGADLD 564


Lambda     K      H
   0.319    0.135    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1004
Number of extensions: 53
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 594
Length of database: 579
Length adjustment: 37
Effective length of query: 557
Effective length of database: 542
Effective search space:   301894
Effective search space used:   301894
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory