Align Sugar ABC transporter, periplasmic sugar-binding protein (characterized, see rationale)
to candidate SMc03165 SMc03165 transcriptional regulator
Query= uniprot:Q9WXW9 (335 letters) >FitnessBrowser__Smeli:SMc03165 Length = 345 Score = 85.9 bits (211), Expect = 1e-21 Identities = 58/182 (31%), Positives = 91/182 (50%), Gaps = 8/182 (4%) Query: 90 GIAIAPSDPTAVIPTIKKALEMGIPVVTLDTDSPDSGRYVYIGTDNYQAGYTAGLIMKEL 149 G+A+ D V +K+ E GI VVTL +D P SGR + G DN AG TAG +M Sbjct: 123 GVAVVAVDAPEVTEAVKRLREDGIAVVTLVSDLPGSGRDHFAGVDNVAAGRTAGSLMGRF 182 Query: 150 L-GGKGKVVIGTGSLTAMNSLQRIQGFKDAIKDSEI--EIVDILNDEEDGARAVSLAEAA 206 L GG+G V + GS+ + R++GF+ + + I+ ++ +++ + +L A Sbjct: 183 LGGGEGPVAVLAGSMLVRDHRDRLEGFQAVMSEDFAWRRILPVIEGQDNPSLVETLVGAL 242 Query: 207 LNAHPDLDAFFGVYAYNGPAQALV--VKNAGKVGKVKIVCFDTTPDILQYVKEGVIQATM 264 L HPDL G+Y+ + LV ++ AGK V + + TP + G I A + Sbjct: 243 LGQHPDL---AGIYSLGAGNRGLVAALEKAGKGRAVCTIAHELTPHSRAGLLSGTIDALL 299 Query: 265 GQ 266 Q Sbjct: 300 NQ 301 Lambda K H 0.318 0.137 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 220 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 345 Length adjustment: 28 Effective length of query: 307 Effective length of database: 317 Effective search space: 97319 Effective search space used: 97319 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory