Align ABC-type transporter, integral membrane subunit, component of Xylose porter (Nanavati et al. 2006). Regulated by xylose-responsive regulator XylR (characterized)
to candidate SM_b21375 SM_b21375 sugar uptake ABC transporter permease
Query= TCDB::Q9WXW7 (317 letters) >FitnessBrowser__Smeli:SM_b21375 Length = 320 Score = 209 bits (531), Expect = 9e-59 Identities = 109/296 (36%), Positives = 183/296 (61%), Gaps = 2/296 (0%) Query: 14 GPLVALVSLAVFTAILNPRFLTAFNLQALGRQIAIFGLLAIGETFVIISGGGAIDLSPGS 73 G ++LV L + + NPRF+T N + +Q+A+ + A G T+VI+ G IDLS GS Sbjct: 20 GIFLSLVMLCIVFSFFNPRFMTVVNFMNILQQVAVVAIAAFGMTWVILLG--EIDLSVGS 77 Query: 74 MVALTGVMVAWLMTHGVPVWISVILILLFSIGAGAWHGLFVTKLRVPAFIITLGTLTIAR 133 ++A+ G++ A G+ ++ L L G +G+ KL +P+FI+T+ T+ I R Sbjct: 78 IIAVAGMVGAQCFAFGMGFAPAIALTLAAGALMGMLNGVLTAKLLLPSFIVTVATMGIYR 137 Query: 134 GMAAVITKGWPIIGLPSSFLKIGQGEFLKIPIPVWILLAVALVADFFLRKTVYGKHLRAS 193 GM ++ T G P + ++ IG FL +PI +W++ + ++ L KT +G+ + Sbjct: 138 GMVSLPTNGAPAMIENETWTAIGTESFLGLPIIIWVVAVLFVINQIVLSKTSFGRRAYLT 197 Query: 194 GGNEVAARFSGVNVDRVRMIAFMVSGFLAGVVGIIIAARLSQGQPGVGSMYELYAIASTV 253 GGN AA +SG+ VDR++++ FM+SG +A + G+++++RL Q G YEL AIA+ V Sbjct: 198 GGNREAAVYSGIKVDRLKILIFMISGVMAAISGVLLSSRLFSAQTNAGMSYELDAIAAAV 257 Query: 254 IGGTSLTGGEGSVLGAIVGASIISLLWNALVLLNVSTYWHNVVIGIVIVVAVTLDI 309 +GGTSL GG G+++G ++GA II ++ N + +L+V ++ +V G+VI+VAV LD+ Sbjct: 258 LGGTSLAGGVGTMVGTLIGALIIGVMNNGMNMLSVPYFYQLIVKGLVILVAVWLDV 313 Lambda K H 0.328 0.143 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 319 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 320 Length adjustment: 27 Effective length of query: 290 Effective length of database: 293 Effective search space: 84970 Effective search space used: 84970 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory