Align Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized)
to candidate SM_b20929 SM_b20929 sugar uptake ABC transporter permease
Query= TCDB::G4FGN4 (313 letters) >FitnessBrowser__Smeli:SM_b20929 Length = 332 Score = 225 bits (573), Expect = 1e-63 Identities = 127/323 (39%), Positives = 190/323 (58%), Gaps = 20/323 (6%) Query: 2 WKKLFKAREAGIFLILIAIVV---FLGVTTREFLTVENIFTVILNVSFIAIMSFGMTMVI 58 W A +A F +L+A+++ FL + T F T +N++ + N +F+AI++ GMT+VI Sbjct: 16 WLSFLLASQA--FWVLVAVILACLFLSIATDSFATAKNLYNITRNFTFVAIIALGMTLVI 73 Query: 59 ITSGIDLSVGSILGAASVVMGLLMDEKGLSPFLSVVIGLAVGVGFGLA----NGLLITKA 114 IT GIDLSVGS+L S+V+ ++M + +G+A +G L NG++I Sbjct: 74 ITGGIDLSVGSVLCLCSMVLAVVMHAG-----YGIEVGIAASIGTALVAGAFNGVMIAYL 128 Query: 115 RLAPFISTLGMLSVGRGLAYVMSGGWPISPF-PESFTVHGQG----MVGPVPVPVIYMAV 169 PF+ TLGMLS+ R LA V S + F P+ T+ G +G + PV+YM V Sbjct: 129 GFPPFVITLGMLSIARSLAMVASNNTVVFEFGPDHDTLLALGGGAWFLG-IANPVLYMIV 187 Query: 170 IGVIAHIFLKYTVTGRRIYAIGGNMEASKLVGIKTDRILILVYTINGFLAAFAGFLLTAW 229 + ++ L++T GR ++AIGGN A+ L G+ RI + VY I+ A AG + T W Sbjct: 188 LALLTGFVLRWTKFGRYVFAIGGNEHAATLTGVPVRRIKVAVYMISALAAGIAGIIQTGW 247 Query: 230 LGVAQPNAGQGYELDVIAATVIGGTSLSGGEGTILGAFLGAVIMGVLRNGMILLGVSSFW 289 LG N G G EL VIAA VIGG +L+GG GT GA +GA ++ V+RN + LLG+++FW Sbjct: 248 LGAVTTNIGAGMELQVIAAAVIGGANLAGGAGTASGALIGAALIEVIRNSLGLLGINAFW 307 Query: 290 QQVVIGIVIIIAIAIDQIRRAKE 312 Q IG I++A+ D+IR ++ Sbjct: 308 QGAFIGGAIVLAVLFDRIRNFRQ 330 Lambda K H 0.328 0.145 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 295 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 332 Length adjustment: 28 Effective length of query: 285 Effective length of database: 304 Effective search space: 86640 Effective search space used: 86640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory