GapMind for catabolism of small carbon sources

 

Aligments for a candidate for xylK_Tm in Sinorhizobium meliloti 1021

Align Ribose import ATP-binding protein RbsA 1; EC 7.5.2.7 (characterized, see rationale)
to candidate SM_b20713 SM_b20713 sugar uptake ABC transporter ATP-binding protein

Query= uniprot:Q9WXX0
         (520 letters)



>lcl|FitnessBrowser__Smeli:SM_b20713 SM_b20713 sugar uptake ABC
           transporter ATP-binding protein
          Length = 513

 Score =  420 bits (1079), Expect = e-122
 Identities = 231/499 (46%), Positives = 328/499 (65%), Gaps = 11/499 (2%)

Query: 14  ILKAKGIVKRFPGVVAVDNVDFEVYENEIVSLIGENGAGKSTLIKILTGVLKPDAGEILV 73
           +L A+G+ K FPGVVA+D+V+F++    + +L+GENGAGKSTL+KIL G+  PD GE+ +
Sbjct: 23  LLTAEGVRKEFPGVVALDDVEFKLKRGTVHALMGENGAGKSTLMKILAGIYYPDQGEVKL 82

Query: 74  NGERVEFHSPVDAFKKGISVIHQELNLCDNMTVAENIFLAYEAVRGQKRTLSSRVDENYM 133
            G  +   SP+DA + GI++IHQELNL   MTVAENI+     +R + +     VD   M
Sbjct: 83  RGAGIRLKSPLDALENGIAMIHQELNLMPFMTVAENIW-----IRREPKNRFGFVDHGEM 137

Query: 134 YTRSKELLDLIGAKFSPDALVRNLTTAQRQMVEICKALVKEPRIIFMDEPTSSLTVEETE 193
              + +L + +     P+  VR+L+ A RQMVEI KA+  E  ++ MDEPTS+LT  E  
Sbjct: 138 RRMTAKLFERLKIDLDPEIEVRHLSVANRQMVEIAKAVSYESDVLIMDEPTSALTEREVA 197

Query: 194 RLFEIIEMLKSRGISVVFVSHRLDEVMRISDRIVVMRDGKRIGELKKGEFDVDTIIKMMV 253
            LFEII  L+S+GI +V+++H+++E+  I+D   V RDGK IG     E   D II+MMV
Sbjct: 198 HLFEIIRDLRSQGIGIVYITHKMNELFEIADEFSVFRDGKYIGTHLSNEVTRDDIIRMMV 257

Query: 254 GREV-EFFPHGIETRPGEIALEVRNLKWKDKVKNVSFEVRKGEVLGFAGLVGAGRTETML 312
           GRE+ + FP   E   G++ L V+NL      ++VSF+VR GE+LG AGLVG+GR+    
Sbjct: 258 GREITQMFPKE-EVPIGDVVLSVKNLTLNGVFRDVSFDVRAGEILGVAGLVGSGRSNVAE 316

Query: 313 LVFGVNQKESGDIYVNGRKVEIKNPEDAIKMGIGLIPEDRKLQGLVLRMTVKDNIVLPSL 372
            +FGV    SG I ++G++V I +   AI+  +  + EDRK  G +L + + +N+ +  L
Sbjct: 317 TLFGVTPASSGTIAIDGKEVVIDSANKAIRHRMAFLTEDRKDTGCLLILDILENMQIAVL 376

Query: 373 K-KISRWGLVLDERKEEEISEDYVKRLSIKTPSIYQITENLSGGNQQKVVLAKWLATNAD 431
           + K  + G V  ER+     E+  ++L +KTP++ +  ENLSGGNQQKV++ +WL TN  
Sbjct: 377 QDKFVKRGFV-SEREVTAACEEMSRKLRVKTPNLQERVENLSGGNQQKVLIGRWLLTNPR 435

Query: 432 ILIFDEPTRGIDVGAKAEIHRMIRELAAQGKAVIMISSELPEILNLSDRIVVMWEGEITA 491
           ILI DEPTRGIDVGAKAEIHR++ ELA  G AVIMISSE+PE+L +SDRI+VM EG +T 
Sbjct: 436 ILILDEPTRGIDVGAKAEIHRLVTELARNGVAVIMISSEMPEVLGMSDRIMVMHEGRVTG 495

Query: 492 VLDNREKRVTQEEIMYYAS 510
           +LD  E   TQ ++M  A+
Sbjct: 496 ILDRAE--ATQIKVMELAA 512


Lambda     K      H
   0.319    0.138    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 699
Number of extensions: 30
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 520
Length of database: 513
Length adjustment: 35
Effective length of query: 485
Effective length of database: 478
Effective search space:   231830
Effective search space used:   231830
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory