Align ABC transporter for D-Alanine, permease component 2 (characterized)
to candidate Synpcc7942_0247 Synpcc7942_0247 ABC-type permease for basic amino acids and glutamine
Query= reanno::pseudo6_N2E2:Pf6N2E2_5403 (375 letters) >FitnessBrowser__SynE:Synpcc7942_0247 Length = 377 Score = 256 bits (653), Expect = 9e-73 Identities = 150/369 (40%), Positives = 217/369 (58%), Gaps = 19/369 (5%) Query: 4 WVFQVVTVVAVIALGWFLFDNTQTNLQHRGITSGFGFLERSAGFGIAQHLIDYTEADSYA 63 WV+Q++ ++ V +L DN NL RG++ F +L++SAGF I + I Y ADSYA Sbjct: 20 WVWQLLVLLVVGLGAIWLVDNLVYNLSQRGLSLSFDWLDQSAGFNIGESAIAYRTADSYA 79 Query: 64 RVFLIGLLNTLLVTFIGVILATILGFIIGVARLSQNWIISKLATVYVEVFRNIPPLLQIL 123 R ++GL+N+L V IG+IL T++G + GVA S+NW++ +L+ YV V RN P LLQ++ Sbjct: 80 RALVVGLVNSLRVIAIGLILTTVIGTLAGVAAFSENWLLRQLSRGYVAVVRNTPLLLQLI 139 Query: 124 FWYFAVFLSMPGPRAAHNFGDTFFVSSRGLNMPAALVAEGFWPFVIS--VVLAIVAIVLM 181 WYF + LS+P + ++ + ++S +G+ +P WP VV+ +A+VL Sbjct: 140 VWYFPILLSLPAAQQPWHWLGSLYLSKQGIYLP--------WPQTPGWLVVILAIALVLF 191 Query: 182 TRWANKRFEATGEPFHKFWVGLALFLVIPALSALLFGAPVHWEMPELKGFNFVGGWVLIP 241 W +R + P W L+ I ++ L+ + W +L+ GG L Sbjct: 192 VSWLAQRQRS---PRDWRW----LYGAIAVVTVLMLLTQLSWPQ-QLQPGQIRGGLRLSL 243 Query: 242 ELLALTLALTVYTAAFIAEIVRSGIKSVSHGQTEAARSLGLRNGPTLRKVIIPQALRVII 301 E AL L L YT AFI EI+R GI SV GQ EAA +LGL TL ++++PQALRVI+ Sbjct: 244 EFTALLLGLVAYTGAFITEIIRGGILSVPAGQWEAAAALGLTRSQTLWQIVVPQALRVIV 303 Query: 302 PPLTSQYLNLAKNSSLAAGIGYPEMVSLFAGTVLNQTGQAIEVIAITMSVYLAISISISL 361 P L SQY+ AKNSSLA +GYP++ + A T LNQTG+ +EV I M YLAI+ IS Sbjct: 304 PSLNSQYVGFAKNSSLAIAVGYPDLYAT-AQTTLNQTGRPVEVFLILMLTYLAINAVISA 362 Query: 362 LMNWYNKRI 370 MN +R+ Sbjct: 363 GMNGLQQRL 371 Lambda K H 0.328 0.141 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 384 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 377 Length adjustment: 30 Effective length of query: 345 Effective length of database: 347 Effective search space: 119715 Effective search space used: 119715 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory