Align Glucosamine-6-phosphate deaminase [isomerizing], alternative (EC 3.5.99.6) (characterized)
to candidate Synpcc7942_0534 Synpcc7942_0534 D-fructose-6-phosphate amidotransferase
Query= reanno::pseudo3_N2E3:AO353_04455 (336 letters) >FitnessBrowser__SynE:Synpcc7942_0534 Length = 641 Score = 114 bits (284), Expect = 9e-30 Identities = 104/334 (31%), Positives = 160/334 (47%), Gaps = 25/334 (7%) Query: 21 PLMIEIAGRLNRQPPQVAMTVARGSSDHAASYFAYLTMQHVGIPVASLPMSVVTMQQAPL 80 P+++ + L QV + +A G+S HA+ YL G+P S +PL Sbjct: 305 PVILNLPDELLNDLEQVQI-LACGTSWHASLVGRYLLETLAGVPTQVYYASEFRYAPSPL 363 Query: 81 KVSGQAVFAFSQSGQSPDLVNSLRLL-RKRGALS-------ISMVNAENSPLEAACEFSL 132 V +QSG++ D + +L +R L + + N S L L Sbjct: 364 -VRNTLTIGVTQSGETADTLAALEKEGERRSGLGPEFAPRLLGITNRSESTLAHVVPHIL 422 Query: 133 PLCAGTESSVAATKSFIATLSASARL---IAYWK--QDPELLQAGLALPEGLRDAATQ-- 185 + AG E VAATK+F+ + A L +AY + Q E L+A +A + + D Q Sbjct: 423 DIQAGIEVGVAATKTFLGQVLAFYGLAIDLAYRRSSQSHEKLEALIAGLKRIPDQIEQLL 482 Query: 186 -DWSLAVDVLR----DCQRLMVIGRGAGFAIAQEAALKLKETSAIQAEAFSSAEVKHGPM 240 + A++ L + Q + +GRG F IA E ALKLKE S I AE + + E+KHGP+ Sbjct: 483 REQDGAIESLAHQFTETQDFIFMGRGINFPIALEGALKLKEISYIHAEGYPAGEMKHGPI 542 Query: 241 ALIDDNYPLLVFAPRGAEQAGLLSLAAEMRQRGARVLLAAPD--DVSERDLTL-SRAEHP 297 AL+D P++ A G+ +LS A E + R AR++ PD D + D L Sbjct: 543 ALLDSKVPVVAIAVPGSVYDKVLSNAQEAKARDARMIGVIPDGPDANMFDHYLWVPIVDE 602 Query: 298 ALDPILAIQSFYVMAAGLAVARGMDPDQPRHLSK 331 L P+L + +++ +A RG+D DQPR+L+K Sbjct: 603 LLSPLLTVVPLQLLSYHIAALRGLDVDQPRNLAK 636 Lambda K H 0.318 0.130 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 476 Number of extensions: 27 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 641 Length adjustment: 33 Effective length of query: 303 Effective length of database: 608 Effective search space: 184224 Effective search space used: 184224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory