Align NgcG, component of N-Acetylglucosamine/N,N'-diacetyl chitobiose porter (NgcK (C) not identified) (characterized)
to candidate Synpcc7942_0471 Synpcc7942_0471 ABC-type sugar transport system permease component-like
Query= TCDB::Q8RJU8 (307 letters) >FitnessBrowser__SynE:Synpcc7942_0471 Length = 276 Score = 172 bits (435), Expect = 1e-47 Identities = 91/260 (35%), Positives = 150/260 (57%), Gaps = 6/260 (2%) Query: 50 AFMVVLPLLWAVMTSFKDDAS-IFG-SPWSLPDKLHFDNWSRAWTEAHMGDYFLNTVLVV 107 A +++PLLW V T+FK IF P LP + DN+ R WTE +G YFLN+ V Sbjct: 20 AVAMLIPLLWLVSTAFKSAGEDIFQFPPQFLPTQPTLDNFRRVWTENPLGQYFLNSTWVA 79 Query: 108 GGSLIGTLVLGSMAAYVLARFDFPGNRFIYYLFIGGMSFPIMLALVPLFYVVNNMGLLNT 167 ++ L+ S+AAY LAR +F G + ++ L + + P + ++PL+ ++ N+GL NT Sbjct: 80 LLTVGLNLLFCSLAAYPLARLEFKGRQTLFLLIVATILIPFQVVMIPLYVLIINLGLRNT 139 Query: 168 LHGLILVYIAYSLPFTVFFLTAFFRTLPSSVAEAAFVDGASHTRTFFQIMLPMAKPGLIS 227 GL+ Y+A + F +F L F+ +P + EAA +DG + ++ +M+P A+P LI+ Sbjct: 140 YLGLVFPYLASA--FGIFLLRQAFQGIPKDLEEAARIDGCNDLGVWWNVMIPSARPALIT 197 Query: 228 VGIFNFLGQWNQYMLPTVLNTDPDKRVLTQGLVQLAVSQGYKGDWSGLFAGLVMAMLPVL 287 + IF F+G W+ ++ P ++ +PD+ L G+ LA G+ DW + AG V+++LPV Sbjct: 198 LAIFVFIGSWSDFLWPLIILDEPDRYTLPLGIATLA--SGFSLDWRLVAAGSVLSILPVF 255 Query: 288 AAYIIFQRQVVQGLTAGALK 307 ++ QR +V A +K Sbjct: 256 GVFLALQRYIVPSAAASGVK 275 Lambda K H 0.326 0.141 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 274 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 276 Length adjustment: 26 Effective length of query: 281 Effective length of database: 250 Effective search space: 70250 Effective search space used: 70250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory