Align AraV, component of Arabinose, fructose, xylose porter (characterized)
to candidate Synpcc7942_0947 Synpcc7942_0947 ATPase
Query= TCDB::Q97UF2 (371 letters) >FitnessBrowser__SynE:Synpcc7942_0947 Length = 355 Score = 188 bits (477), Expect = 2e-52 Identities = 105/336 (31%), Positives = 194/336 (57%), Gaps = 9/336 (2%) Query: 9 LSKIFKKGKTEVKAVDNVSITIDSGMAFGVLGPSGHGKTTFLRLIAGLEEPTSGYIYFDN 68 L ++ K V V N+S+ + G +LGPSG GK+T LRLIAGL++PTSG I+ + Sbjct: 8 LRQLRKAYSPSVVPVANLSLQLQPGEFLTLLGPSGCGKSTTLRLIAGLDQPTSGSIWLGD 67 Query: 69 EAVSSPRRVMMSPEKRGIAMVFQNWALYPNMTVFDNIAFPLKLAKVPKDKIENKVKEVSE 128 +++ + P R +AMVFQ++ALYP++ V N+ L++ + +IE ++++V+ Sbjct: 68 REITT-----LPPGDRDMAMVFQSYALYPHLNVRQNLTLGLQIRRTSAAEIEQRLQQVAH 122 Query: 129 ELGLSGVLNRYPKELSGGQMQRTAIARALVKDPKVLLLDEPFSNLDAQIRESARALVRKI 188 L L +L+R P +LSGGQ QR A+ RALV+ P V LLDEP SNLDA +RE RA ++ + Sbjct: 123 NLELDHLLDRRPAQLSGGQRQRVALGRALVRQPSVFLLDEPLSNLDALLREQVRAQMKAL 182 Query: 189 QRERKLTTLIVSHDPADIFAIANKAGVIVNGKFAQIGTPTEIYEYPATDLIARLTG--EI 246 ++ + V+HD + +++++ ++ G Q+ +P IY+ PA +A G + Sbjct: 183 FSQQASPVVYVTHDQTEALSLSHRIAILNGGHLQQLDSPDRIYQAPANAFVAGFIGSPRM 242 Query: 247 NLIQAKIIENNAIIANLKVPLNNMELKGQSNIVIGLRPDDLTLSDTLLDKYIDMGIVKVK 306 NL+ I A + + +P+ + L +S ++ GLRP+ L L+ +++ I + + + Sbjct: 243 NLLPLPIHSGQAWLGSRALPIPS-HLAARSQVLWGLRPEHLKLATPEVERAIPVQLHLTE 301 Query: 307 LVSYGAGIFKIVVSPITDENIDIIVDAEEPLETGIE 342 + + + ++ + + +++ +++P+ T ++ Sbjct: 302 NLGM-QRLLTVAIAANPEVRLRLLMPSDQPIPTDLQ 336 Lambda K H 0.317 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 248 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 355 Length adjustment: 29 Effective length of query: 342 Effective length of database: 326 Effective search space: 111492 Effective search space used: 111492 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory