Align Glyoxylate reductase; EC 1.1.1.26 (uncharacterized)
to candidate Synpcc7942_1501 Synpcc7942_1501 D-3-phosphoglycerate dehydrogenase
Query= curated2:B1L765 (332 letters) >FitnessBrowser__SynE:Synpcc7942_1501 Length = 546 Score = 200 bits (508), Expect = 8e-56 Identities = 111/305 (36%), Positives = 184/305 (60%), Gaps = 8/305 (2%) Query: 3 PRVFVTREIPERGLSKIEEHFELDLWKDEAPPSKKVIIERVKDCDALVSLLTDPIDAEVF 62 P+V V+ I + GL + + ++D+ K PS+ + + + + DAL+ + AEV Sbjct: 19 PKVLVSDPIDQVGLDILSQVAQVDV-KTGLSPSE--LAQIIGEYDALMLRSGTRVTAEVI 75 Query: 63 EAAPKLRIVAQYAVGYDNIDVKEATKRGIYVTNTPGVLTETTADFAFALLMAAARRVVEA 122 EA KLRI+ + VG DN+DV AT+RGI V N+P T A+ A++++ +R + +A Sbjct: 76 EAGQKLRIIGRAGVGVDNVDVPAATRRGIVVVNSPEGNTIAAAEHTLAMMLSLSRHIPDA 135 Query: 123 DRYVREGKWKVAWHPMMMLGYDVYGRTLGIVGMGRIGAAVARRAKGFGMRILYYDSIRRE 182 + + G W +G +VY +TLG+VG+G+IG+ VA AK GM++L YD Sbjct: 136 NASTKSG----GWDRKSFVGTEVYKKTLGVVGLGKIGSHVATVAKAMGMKLLAYDPFISA 191 Query: 183 DFEKELGVEYVPLEKLLEESDFVSLHVPLTEETYHMIGEEQLRRMKRTAILVNTSRGKVV 242 + +++G V L+ L +E+D+++LH+P T ET ++I E L +MK T ++N +RG V+ Sbjct: 192 ERAEQIGARLVELDILFQEADYITLHIPKTPETANLINAETLAKMKPTTRIINCARGGVI 251 Query: 243 DQKALYKALKEGWIAGAGLDVFEQEPIPPDDPLLKL-ENVVLAPHAASASHETRSRMAEM 301 +++AL A+ G I GA LDV++QEP+ D PL L +N++L PH +++ E + +A Sbjct: 252 NEQALADAIAAGKIGGAALDVYDQEPLQADSPLRALGKNLILTPHLGASTTEAQVNVAVD 311 Query: 302 VAENL 306 VAE + Sbjct: 312 VAEQI 316 Lambda K H 0.319 0.137 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 412 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 546 Length adjustment: 32 Effective length of query: 300 Effective length of database: 514 Effective search space: 154200 Effective search space used: 154200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory