Align Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale)
to candidate Synpcc7942_0960 Synpcc7942_0960 ATPase
Query= uniprot:D4GP38 (383 letters) >FitnessBrowser__SynE:Synpcc7942_0960 Length = 417 Score = 299 bits (766), Expect = 8e-86 Identities = 181/380 (47%), Positives = 232/380 (61%), Gaps = 36/380 (9%) Query: 14 GDTVAVDDLSLDIDDEEFLVLVGPSGCGKSTTLRMLAGLETPTSGDIYIGGDHMNYRVPQ 73 G+ V ++ ++L+I D EF+V+VGPSGCGKST LR+LAGLETP+ G I +G ++ + Sbjct: 45 GEVVVLNGINLEIADGEFMVVVGPSGCGKSTLLRLLAGLETPSRGLIKVGDRRVDRLPAK 104 Query: 74 NRDIAMVFQDYALYPHMTVRQNIRFGLEEE-----------------------EGYTSAE 110 RDIAMVFQ YALYPH++V N+ FGL + E A Sbjct: 105 ARDIAMVFQSYALYPHLSVYDNLAFGLRRQGDRPWWQQQLALATRSLPKSLQYEPEQEAR 164 Query: 111 RDERVVEVAETLGIADLLDRKPDELSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLR 170 RV EVA L + LLDR+P +LSGGQ+QRVALGRAI R+P+VFLMDEPLSNLDAKLR Sbjct: 165 IKRRVREVATMLQLDTLLDRQPKQLSGGQKQRVALGRAIARNPQVFLMDEPLSNLDAKLR 224 Query: 171 AEMRTELQNLQDQLAVTTVYVTHNQTEAMTMADRIAVMDDGELQQVASPFECYHEPNNLF 230 AE R ++ +LQ QL VTT+YVTH+QTEAMTM DRIAV++ G LQQVASP E Y P N F Sbjct: 225 AETRAQIVSLQRQLGVTTLYVTHDQTEAMTMGDRIAVLNRGHLQQVASPLEIYDRPANRF 284 Query: 231 VAEFIGEPMINLVRGT-RSESTFVGEHFSYPLDE--DVMESVDDRDDFVLGVRPEDIEVA 287 VA+FIG P +NL+ T R+ E+F L E + + + D LG+RPE +EV Sbjct: 285 VAQFIGSPPMNLIPVTVRAPLQLTTENFRCTLPEAWEPVLRLYDGQTVELGIRPEHLEVG 344 Query: 288 DAAPDDAALDDHDLQMDVTVVEPHGDQNVLHLSHPDQPSADDALQAVTEGMHLVTRGDRV 347 AA +L + VT VE G + + + A+QA GDR+ Sbjct: 345 AAA-------SKNLLITVTGVEALGSDTFI---AGELKESGIAVQARLAPQQCWQMGDRL 394 Query: 348 TVTIPPDKIHLFDAETGTAV 367 +T PD+IHLFD ETG A+ Sbjct: 395 WLTFKPDQIHLFDLETGKAI 414 Lambda K H 0.317 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 405 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 417 Length adjustment: 31 Effective length of query: 352 Effective length of database: 386 Effective search space: 135872 Effective search space used: 135872 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory