Align Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale)
to candidate Synpcc7942_0960 Synpcc7942_0960 ATPase
Query= uniprot:D4GP39 (383 letters) >FitnessBrowser__SynE:Synpcc7942_0960 Length = 417 Score = 306 bits (784), Expect = 7e-88 Identities = 186/400 (46%), Positives = 243/400 (60%), Gaps = 40/400 (10%) Query: 1 MARLTLDDVTKVYTDEGG----GDIVAVEEISLDIDDGEFLVLVGPSGCGKSTTLRMMAG 56 +A + +++ K + ++ G++V + I+L+I DGEF+V+VGPSGCGKST LR++AG Sbjct: 23 VAGVVFEEIEKRFPEQARSPQKGEVVVLNGINLEIADGEFMVVVGPSGCGKSTLLRLLAG 82 Query: 57 LETVTEGELRLEDRVLNGVSAQDRDIAMVFQSYALYPHKSVRGNMSFGLEESTGLP---- 112 LET + G +++ DR ++ + A+ RDIAMVFQSYALYPH SV N++FGL P Sbjct: 83 LETPSRGLIKVGDRRVDRLPAKARDIAMVFQSYALYPHLSVYDNLAFGLRRQGDRPWWQQ 142 Query: 113 -------------------DDEIRQRVEETTDMLGISDLLDRKPGQLSGGQQQRVALGRA 153 + I++RV E ML + LLDR+P QLSGGQ+QRVALGRA Sbjct: 143 QLALATRSLPKSLQYEPEQEARIKRRVREVATMLQLDTLLDRQPKQLSGGQKQRVALGRA 202 Query: 154 IVRDPEVFLMDEPLSNLDAKLRAEMRTELQRLQGELGVTTVYVTHDQTEAMTMGDRVAVL 213 I R+P+VFLMDEPLSNLDAKLRAE R ++ LQ +LGVTT+YVTHDQTEAMTMGDR+AVL Sbjct: 203 IARNPQVFLMDEPLSNLDAKLRAETRAQIVSLQRQLGVTTLYVTHDQTEAMTMGDRIAVL 262 Query: 214 DDGELQQVGTPLDCYHRPNNLFVAGFIGEPSMNLFDGSLSGD-TFRGDGFDYPLSGATRD 272 + G LQQV +PL+ Y RP N FVA FIG P MNL ++ + F L A Sbjct: 263 NRGHLQQVASPLEIYDRPANRFVAQFIGSPPMNLIPVTVRAPLQLTTENFRCTLPEAWEP 322 Query: 273 QLGGASGLT--LGIRPEDVTVGERRSGQRTFDAEVVVVEPQGNENAVHLRFVDG---DEG 327 L G T LGIRPE + VG S + V VE G++ F+ G + G Sbjct: 323 VLRLYDGQTVELGIRPEHLEVGAAAS--KNLLITVTGVEALGSDT-----FIAGELKESG 375 Query: 328 TQFTATTTGQSRVEAGDRTTVSFPEDAIHLFDGETGDALK 367 A Q + GDR ++F D IHLFD ETG A++ Sbjct: 376 IAVQARLAPQQCWQMGDRLWLTFKPDQIHLFDLETGKAIR 415 Lambda K H 0.316 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 476 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 417 Length adjustment: 31 Effective length of query: 352 Effective length of database: 386 Effective search space: 135872 Effective search space used: 135872 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory