Align histidine transport ATP-binding protein hisP (characterized)
to candidate Synpcc7942_1414 Synpcc7942_1414 ATPase
Query= CharProtDB::CH_003210 (257 letters) >FitnessBrowser__SynE:Synpcc7942_1414 Length = 241 Score = 147 bits (372), Expect = 2e-40 Identities = 95/225 (42%), Positives = 132/225 (58%), Gaps = 16/225 (7%) Query: 13 KRYGEHEV----LKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSEGSIVVNGQT 68 K YGE E L V Q AG+ +I+G+SGSGKST + I L++P+ G ++G Sbjct: 16 KIYGEGETTVRALDHVDFQVRAGEYCAIMGASGSGKSTAMNLIGCLDRPTAGRYYLDGTD 75 Query: 69 INLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKQEA 128 V D D A +N+ ++ VFQ F+L ++ +ENVM P+ G+S+QE Sbjct: 76 ---VADLDDDALAAVRNR------KIGFVFQQFHLLPQLSAVENVM-LPMIYAGISQQER 125 Query: 129 RERAVKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPEVLLFDEPTSALDPELV 188 R+RAV L +VG+ +R K P LSGGQQQRV+IARA+ +P +LL DEPT ALD + Sbjct: 126 RDRAVAALTQVGLAQRLDNK-PNQLSGGQQQRVAIARAIVNQPVLLLADEPTGALDSQTT 184 Query: 189 GEVLRIMQQLAEEGKTMVVVTHEMGFARHVSTHVIFLHQGKIEEE 233 EVL I QL + G T+V+VTHE A + VI+ G+I+ E Sbjct: 185 EEVLNIFDQLHQRGITIVIVTHEAEVADR-AERVIWFRDGQIQRE 228 Lambda K H 0.318 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 158 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 241 Length adjustment: 24 Effective length of query: 233 Effective length of database: 217 Effective search space: 50561 Effective search space used: 50561 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory