Align ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized)
to candidate Synpcc7942_0960 Synpcc7942_0960 ATPase
Query= reanno::Smeli:SMc04256 (361 letters) >FitnessBrowser__SynE:Synpcc7942_0960 Length = 417 Score = 252 bits (644), Expect = 1e-71 Identities = 160/373 (42%), Positives = 215/373 (57%), Gaps = 36/373 (9%) Query: 14 GAVTVLDRLNLDIDHGEFLVLLGSSGCGKSTLLNCIAGLLDVSDGQIFIKDRNVTWEEPK 73 G V VL+ +NL+I GEF+V++G SGCGKSTLL +AGL S G I + DR V K Sbjct: 45 GEVVVLNGINLEIADGEFMVVVGPSGCGKSTLLRLLAGLETPSRGLIKVGDRRVDRLPAK 104 Query: 74 DRGIGMVFQSYALYPQMTVEKNLSFGLKVAKIPP------------------------AE 109 R I MVFQSYALYP ++V NL+FGL+ P A Sbjct: 105 ARDIAMVFQSYALYPHLSVYDNLAFGLRRQGDRPWWQQQLALATRSLPKSLQYEPEQEAR 164 Query: 110 IEKRVKRASEILQIQPLLKRKPSELSGGQRQRVAIGRALVRDVDVFLFDEPLSNLDAKLR 169 I++RV+ + +LQ+ LL R+P +LSGGQ+QRVA+GRA+ R+ VFL DEPLSNLDAKLR Sbjct: 165 IKRRVREVATMLQLDTLLDRQPKQLSGGQKQRVALGRAIARNPQVFLMDEPLSNLDAKLR 224 Query: 170 SELRVEIKRLHQSLKNTMIYVTHDQIEALTLADRIAVMKSGVIQQLADPMTIYNAPENLF 229 +E R +I L + L T +YVTHDQ EA+T+ DRIAV+ G +QQ+A P+ IY+ P N F Sbjct: 225 AETRAQIVSLQRQLGVTTLYVTHDQTEAMTMGDRIAVLNRGHLQQVASPLEIYDRPANRF 284 Query: 230 VAGFIGSPSMNFFRGEVEPKDGRSFVRAGGIAFDVT---AYPAHTRLQPGQKVVLGLRPE 286 VA FIGSP MN P R+ ++ F T A+ RL GQ V LG+RPE Sbjct: 285 VAQFIGSPPMNLI-----PVTVRAPLQLTTENFRCTLPEAWEPVLRLYDGQTVELGIRPE 339 Query: 287 HVKVDEARDGEPTHQAVVDIEEPMGADNLL--WLTFAGQSMSVRIAGQRRYPPGSTVRLS 344 H++V A V E +G+D + L +G ++ R+A Q+ + G + L+ Sbjct: 340 HLEVGAA--ASKNLLITVTGVEALGSDTFIAGELKESGIAVQARLAPQQCWQMGDRLWLT 397 Query: 345 FDMGVASIFDAES 357 F +FD E+ Sbjct: 398 FKPDQIHLFDLET 410 Lambda K H 0.320 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 421 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 417 Length adjustment: 30 Effective length of query: 331 Effective length of database: 387 Effective search space: 128097 Effective search space used: 128097 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory