Align CbtC, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate Synpcc7942_0445 Synpcc7942_0445 ABC-type dipeptide/oligopeptide/nickel transport systems permease components-like
Query= TCDB::Q97VF6 (290 letters) >FitnessBrowser__SynE:Synpcc7942_0445 Length = 351 Score = 98.6 bits (244), Expect = 2e-25 Identities = 59/186 (31%), Positives = 105/186 (56%), Gaps = 8/186 (4%) Query: 65 IFGTGPFAESILVQIIQGAKSVIEISFLAGLFATLIGIVVGIIAGYLGGIIDNILMGITD 124 + GT +++ G++ + + + + +GI+VG IAGY GG +D ++M + + Sbjct: 125 LLGTDDQGRDQFSRLLYGSRISLSVGLVGVILTFPLGILVGGIAGYWGGWVDALIMRLVE 184 Query: 125 IILTLPSLILIIIIVSAFK---TSNPIFLSLILSITS---WAGLARAVRSQVLVIRNSPA 178 +++T+PSL L++ + + +S FL LI++ITS WAGLAR +R QVL +R Sbjct: 185 VLMTIPSLYLLVALAAVLPPGLSSAERFL-LIVAITSLINWAGLARVIRGQVLSLREREY 243 Query: 179 VEVLRVLGLSRKYIIFREVVPTLGSYIAIHYIFNVEAAVYAEVGLYYLGVLPYNPN-NWG 237 V+ +V+G SR Y++ R ++P +Y+ I V + + AE L +G+ P+ +WG Sbjct: 244 VQASQVMGASRLYLLIRHILPQTLTYVIIAATLAVPSFIVAESVLSLVGLGIQQPDPSWG 303 Query: 238 AMIQQA 243 M+ A Sbjct: 304 NMLSLA 309 Lambda K H 0.328 0.146 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 302 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 351 Length adjustment: 28 Effective length of query: 262 Effective length of database: 323 Effective search space: 84626 Effective search space used: 84626 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory