Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate Synpcc7942_1414 Synpcc7942_1414 ATPase
Query= reanno::pseudo1_N1B4:Pf1N1B4_3435 (254 letters) >FitnessBrowser__SynE:Synpcc7942_1414 Length = 241 Score = 140 bits (354), Expect = 2e-38 Identities = 89/235 (37%), Positives = 134/235 (57%), Gaps = 16/235 (6%) Query: 4 LEVQDLHKRYGSHEV----LKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGK 59 ++ + + K YG E L V + AG+ +I+G+SGSGKST + I L++P AG+ Sbjct: 9 IQFEHVSKIYGEGETTVRALDHVDFQVRAGEYCAIMGASGSGKSTAMNLIGCLDRPTAGR 68 Query: 60 ILLNNEELKLVANKDGALKAADPKQLQRMRSR-LSMVFQHFNLWSHMTAMENIMEAPVHV 118 L+ + VA+ D AA +R+R + VFQ F+L ++A+EN+M P+ Sbjct: 69 YYLDGTD---VADLDDDALAA-------VRNRKIGFVFQQFHLLPQLSAVENVM-LPMIY 117 Query: 119 LGMSKTEAREKAEHYLNKVGVAHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTS 178 G+S+ E R++A L +VG+A R D P +SGG+QQRVAIARA+ +P ++L DEPT Sbjct: 118 AGISQQERRDRAVAALTQVGLAQRLDNKPNQLSGGQQQRVAIARAIVNQPVLLLADEPTG 177 Query: 179 ALDPELVGDVLKVMQALAQEGRTMVVVTHEMGFAREVSNQLVFLHKGVVEESGNP 233 ALD + +VL + L Q G T+V+VTHE A + F + E+ NP Sbjct: 178 ALDSQTTEEVLNIFDQLHQRGITIVIVTHEAEVADRAERVIWFRDGQIQRETQNP 232 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 135 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 241 Length adjustment: 24 Effective length of query: 230 Effective length of database: 217 Effective search space: 49910 Effective search space used: 49910 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory