Align ornithine carbamoyltransferase (EC 2.1.3.3) (characterized)
to candidate Synpcc7942_2514 Synpcc7942_2514 ornithine carbamoyltransferase
Query= BRENDA::Q51742 (315 letters) >FitnessBrowser__SynE:Synpcc7942_2514 Length = 305 Score = 303 bits (775), Expect = 4e-87 Identities = 160/312 (51%), Positives = 211/312 (67%), Gaps = 8/312 (2%) Query: 3 VSLAGRDLLCLQDYTAEEIWTILETAKMFKIWQK-IGKPHRLLEGKTLAMIFQKPSTRTR 61 + LAGRDLL L D ++ E+ ILE A K Q + P KTL +IF K STRTR Sbjct: 1 MGLAGRDLLTLADLSSAEVLEILELAATLKSGQTTVHCP------KTLGLIFSKSSTRTR 54 Query: 62 VSFEVAMAHLGGHALYLNAQDLQLRRGETIADTARVLSRYVDAIMARVYDHKDVEDLAKY 121 VSF A+ +GG L LN Q+ RGE IADTARVLSRY+DA+ R + +D+E+ A Y Sbjct: 55 VSFSAAIMQMGGQVLDLNPNVTQVGRGEPIADTARVLSRYLDALAIRTFAQQDLEEYAHY 114 Query: 122 ATVPVINGLSDFSHPCQALADYMTIWEKKGTIKGVKVVYVGDGNNVAHSLMIAGTKLGAD 181 A +PVIN L+D HPCQ LAD TI E G + + + Y+GDGNNVAHSL++ ++G + Sbjct: 115 ADIPVINALTDDYHPCQILADLQTIQENFGQWQDLTLTYLGDGNNVAHSLLLGCAQVGMN 174 Query: 182 VVVATPEGYEPDEKVIKWAEQNAAESGGSFELLHDPVKAVKDADVIYTDVWASMGQEAEA 241 V +A P Y+P E+++ A+Q A + E+LHDP+ A + A V+YTDVWASMGQE EA Sbjct: 175 VRIACPPDYQPQERIVAKAQQIAGDR-AKVEILHDPIAASQGAHVLYTDVWASMGQEEEA 233 Query: 242 EERRKIFRPFQVNKDLVKHAKPDYMFMHCLPAHRGEEVTDDVIDSPNSVVWDQAENRLHA 301 + R K F P+Q+N+ L++ A P + +HCLPAHR EE+T +V++ S VWDQAENRLHA Sbjct: 234 QARVKAFTPYQLNQALLEKADPAAIVLHCLPAHREEEITAEVLEGSQSRVWDQAENRLHA 293 Query: 302 QKAVLALVMGGI 313 QKAVLAL++G I Sbjct: 294 QKAVLALLLGAI 305 Lambda K H 0.319 0.134 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 283 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 315 Length of database: 305 Length adjustment: 27 Effective length of query: 288 Effective length of database: 278 Effective search space: 80064 Effective search space used: 80064 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate Synpcc7942_2514 Synpcc7942_2514 (ornithine carbamoyltransferase)
to HMM TIGR00658 (argF: ornithine carbamoyltransferase (EC 2.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00658.hmm # target sequence database: /tmp/gapView.1860800.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00658 [M=304] Accession: TIGR00658 Description: orni_carb_tr: ornithine carbamoyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-129 415.5 0.0 7.1e-129 415.3 0.0 1.0 1 lcl|FitnessBrowser__SynE:Synpcc7942_2514 Synpcc7942_2514 ornithine carbam Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__SynE:Synpcc7942_2514 Synpcc7942_2514 ornithine carbamoyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 415.3 0.0 7.1e-129 7.1e-129 1 303 [. 6 302 .. 6 303 .. 0.98 Alignments for each domain: == domain 1 score: 415.3 bits; conditional E-value: 7.1e-129 TIGR00658 1 rhllslldlseeelkellelakklkkekkkgkeekklkgktlaliFekrstRtRvsfevaayelGaqvl 69 r+ll+l+dls++e+ e+lela++lk+ +++ + ktl+liF k+stRtRvsf +a++++G+qvl lcl|FitnessBrowser__SynE:Synpcc7942_2514 6 RDLLTLADLSSAEVLEILELAATLKSGQTT-----VHCPKTLGLIFSKSSTRTRVSFSAAIMQMGGQVL 69 79************************9988.....3489****************************** PP TIGR00658 70 ylnkeelqlgrkesikDtarvlsryvdaivvRvykhedveelakyasvPvingLtdlehPcqilaDllt 138 ln++ +q+gr+e+i+Dtarvlsry+da+++R+++++d+ee a+ya +Pvin+Ltd hPcqilaDl+t lcl|FitnessBrowser__SynE:Synpcc7942_2514 70 DLNPNVTQVGRGEPIADTARVLSRYLDALAIRTFAQQDLEEYAHYADIPVINALTDDYHPCQILADLQT 138 ********************************************************************* PP TIGR00658 139 ikeklgklkevklvyvGDannvanslllaaaklGldvvvatPeglepeaeivkkakkiakenggklelt 207 i+e++g+ ++++l+y+GD+nnva+slll++a++G++v++a+P++++p+++iv ka++ia +k+e++ lcl|FitnessBrowser__SynE:Synpcc7942_2514 139 IQENFGQWQDLTLTYLGDGNNVAHSLLLGCAQVGMNVRIACPPDYQPQERIVAKAQQIAG-DRAKVEIL 206 *******************************************************99765.569***** PP TIGR00658 208 edpkkavkdadviytDvwvsmGeeekkeerlkllkpyqvneellelakpevkflhCLPavrGeevtdev 276 +dp a+++a+v+ytDvw+smG+ee++++r+k++ pyq+n+ lle a+p +++lhCLPa+r ee+t ev lcl|FitnessBrowser__SynE:Synpcc7942_2514 207 HDPIAASQGAHVLYTDVWASMGQEEEAQARVKAFTPYQLNQALLEKADPAAIVLHCLPAHREEEITAEV 275 ********************************************************************* PP TIGR00658 277 legeasivfdeaenRlhaqkavlkall 303 leg++s+v+d+aenRlhaqkavl++ll lcl|FitnessBrowser__SynE:Synpcc7942_2514 276 LEGSQSRVWDQAENRLHAQKAVLALLL 302 ***********************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (305 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 20.94 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory