Align NAD-dependent succinate semialdehyde dehydrogenase (EC 1.2.1.24) (characterized)
to candidate Synpcc7942_1857 Synpcc7942_1857 3-hydroxyacid dehydrogenase
Query= metacyc::MONOMER-15565 (287 letters) >FitnessBrowser__SynE:Synpcc7942_1857 Length = 288 Score = 154 bits (388), Expect = 3e-42 Identities = 88/283 (31%), Positives = 144/283 (50%), Gaps = 3/283 (1%) Query: 5 GFLGIGIMGKAMAVNLLRHGFKVTVWNRTLSRCDELVQHGASVGETPAEVIKKCKYTIAM 64 G +G G++G A+A LL G +TVWNRT R LV GA++ TPA ++ C+ + + Sbjct: 4 GLIGTGLLGTAIAERLLTVGQLLTVWNRTAERSQPLVALGATIAPTPAALLADCEVCLLL 63 Query: 65 LSDPAAALSVVFDKHGALEHICAGKGYIDMSTVDADTSSQISQAITSKGGSFLEAPVSGS 124 LSD A + + + + + GK I M T+ S I+ I + GG +LEAPV GS Sbjct: 64 LSDAEAIAATLLTEESRSQLV--GKTIIQMGTISPAESRAIADQIAAAGGQYLEAPVLGS 121 Query: 125 KKPAEDGQLVILAAGDKDLYDQVVPAFDVLGKKSFFLGKIGNGAKMKLVVNMIMGSMMNA 184 A +G L+++ + +++Q L + ++G IG A +KL +N ++GS+ +A Sbjct: 122 LPEARNGTLIVMVGAEPAVFEQWRSLLCHLSPEPEWIGPIGTAATLKLALNQLIGSLTSA 181 Query: 185 FSEGIVLADKSGLDPHTLLDVLDLGAIANPMFKMKGPAMIKNSYP-PAFPLKHQQKDMRL 243 F + L +SGL + +L A+ P F K ++ + Y P FP H KD+RL Sbjct: 182 FGGSLALLQRSGLAVEPFMAILRQSALYAPTFDKKLSRLLSHQYDNPNFPTTHLAKDLRL 241 Query: 244 ALALGDENAVPMPVAAAANEAFKKARSLGLGDLDFSAVFETLS 286 + + +KA + G GD D+SA++E ++ Sbjct: 242 FRETAADLGITTDAVEGVESIVQKAIAQGWGDQDYSALYEAIN 284 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 287 Length of database: 288 Length adjustment: 26 Effective length of query: 261 Effective length of database: 262 Effective search space: 68382 Effective search space used: 68382 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory