Align aminobutyraldehyde dehydrogenase (EC 1.2.1.19); betaine-aldehyde dehydrogenase (EC 1.2.1.8) (characterized)
to candidate Synpcc7942_0489 Synpcc7942_0489 aldehyde dehydrogenase
Query= BRENDA::Q9S795 (501 letters) >FitnessBrowser__SynE:Synpcc7942_0489 Length = 459 Score = 174 bits (440), Expect = 8e-48 Identities = 138/417 (33%), Positives = 202/417 (48%), Gaps = 15/417 (3%) Query: 72 AVRAKYLRAIAAKVNERKTDLAKLEALDCGKPLDEA-VWDMDDVAGCFEFYADLAEGLDA 130 A R L+ +A V + + +L + A D KP EA ++ V + Sbjct: 29 AFRLARLQDLAKLVADNEAELLQALASDLRKPALEAYASEIYFVRDQIKLTCKHLRRWMQ 88 Query: 131 KQKAPVSLPMESFKSYVLKQPLGVVGLITPWNYPLLMAVWKVAPSLAAGCTAILKPSELA 190 +K +SL + ++Y +PLGVV +I PWNYP + + + ++AAG A+LKPSELA Sbjct: 89 PEKQSISLMQQPGQAYRQAEPLGVVLIIGPWNYPFQLLITPLIGAIAAGNCAVLKPSELA 148 Query: 191 SVTCLELADICREVGLPPGVLNVLTGFGSEAGAPLASHPGVDKIAFTGSFATGSKVMTAA 250 T + + + P + VL G S + A L + P D I FTG A G KVM AA Sbjct: 149 PATSSLIQRLISD-RFDPDYIRVLEGDASVSQA-LITQP-FDHIFFTGGTAIGRKVMAAA 205 Query: 251 AQLVKPVSMELGGKSPLIVFDDVDLDKAAEWALFGCFWTNGQICSATSRLLVHESIASEF 310 A+ + PV++ELGGKSP IV D+DLD AA +G F+ GQ C A LLV ++A F Sbjct: 206 AENLTPVTLELGGKSPCIVDTDIDLDVAARRIAWGKFFNAGQTCIAPDYLLVQRTVAEPF 265 Query: 311 IEKLVKWSKNIKISDPMEEGCRLGPVVSKGQYEKILKFISTAKSEGATILHGGSRPEHLE 370 IE L+ + DP ++ +VS ++++ + TI HGG Sbjct: 266 IEALIDNIQQFYGEDP-QQSADYARIVSDRHWQRLNSLL-----VDGTIRHGGQVD---R 316 Query: 371 KGFFIEPTIITDVTTSMQIWREEVFGPVLCVKTFASEDEAIELANDSHYGLGAAVISNDT 430 +I PT+ITDV I +EE+FGP+L + + DEAI L + S D Sbjct: 317 SDRYIAPTLITDVNWRDPILQEEIFGPLLPILIYDQLDEAIAQIRAQPKPLALYLFSRDR 376 Query: 431 ERCDRISEAFEAGIVWINCS--QPCFTQAPWGGVKRSGFGRELGEWGLDNYLSVKQV 485 + +R+ AG V +N + Q A +GGV SG G G+ + + K V Sbjct: 377 QVQERVLAETSAGSVCLNDTILQVGVPDAAFGGVGPSGMGGYHGKASFETFSHYKLV 433 Lambda K H 0.318 0.135 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 515 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 501 Length of database: 459 Length adjustment: 34 Effective length of query: 467 Effective length of database: 425 Effective search space: 198475 Effective search space used: 198475 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory