Align alcohol dehydrogenase (EC 1.1.1.1) (characterized)
to candidate Synpcc7942_1573 Synpcc7942_1573 3-oxoacyl-(acyl-carrier protein) reductase
Query= BRENDA::Q4J702 (264 letters) >FitnessBrowser__SynE:Synpcc7942_1573 Length = 266 Score = 134 bits (338), Expect = 2e-36 Identities = 79/250 (31%), Positives = 126/250 (50%), Gaps = 11/250 (4%) Query: 14 AVVLGASSGIGKAIAEMFSEMGGKVVLSDIDE-EGLKRLSDSLRSRGHEVNHMK------ 66 A+V G+S GIG+ IA + G VV+ EG + + + G + + K Sbjct: 9 ALVTGSSQGIGQEIAIRLASEGASVVIDYRSHPEGAEETRKQVEAAGAQCHLAKDHAPEG 68 Query: 67 ----CDITDLNQVKKLVNFSLSVYGNVDALYVTPSINVRKSIENYTYEDFEKVINVNLKG 122 D+ D+ QV+ LV S+ +G +D L + R T D++ V+NVNLKG Sbjct: 69 YVVQADLGDVTQVRNLVAESIKHFGKLDILVNNAGMERRAPFWEVTEADYDMVLNVNLKG 128 Query: 123 NFMVVKEFLSVMKNNKGGGSVVLFSSIRGTVVEPGQSVYAMTKAGIIQLAKVAAAEYGKY 182 F + + + K G ++ SS+ + P + Y ++K GI + + A E G+Y Sbjct: 129 AFFAAQALVQHLLETKRPGKIINISSVHEELPFPNFASYCLSKGGIKMMTRDLAVELGEY 188 Query: 183 NIRVNVIAPGVVDTPLTRQIKSDPEWFKAYTEKTILKRWATPEEIANVALFLAMPASSYI 242 I +N +APG ++TP+ + ++P A LKR P++IA++ LFLA P + YI Sbjct: 189 GITINNVAPGAIETPINTNLLNNPTELNALLGNIPLKRLGKPKDIASLVLFLASPDADYI 248 Query: 243 TGTVIYVDGG 252 TGT I+ DGG Sbjct: 249 TGTTIFADGG 258 Lambda K H 0.317 0.134 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 266 Length adjustment: 25 Effective length of query: 239 Effective length of database: 241 Effective search space: 57599 Effective search space used: 57599 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory