Align Fructokinase-1; ZmFRK1; EC 2.7.1.4 (characterized)
to candidate Synpcc7942_0116 Synpcc7942_0116 fructokinase
Query= SwissProt::Q6XZ79 (323 letters) >FitnessBrowser__SynE:Synpcc7942_0116 Length = 324 Score = 152 bits (383), Expect = 1e-41 Identities = 106/326 (32%), Positives = 163/326 (50%), Gaps = 7/326 (2%) Query: 1 MAAGRELVVSFGEMLIDFVPTVAGVSLAEAPAFLKAPGGAPANVAIAVSRLGGGAAFVGK 60 M A V+ GEML D + + + ++ PGGAPANVA A+ +LG + + Sbjct: 1 MTAQAPTVICLGEMLWDCLANDRDLPAEQVQSWTPWPGGAPANVATALVKLGVQSGLITC 60 Query: 61 LGDDEFGRMLAAILRDNGVDDGGVVFDSGARTALAFVTLRADGEREFMFYR----NPSAD 116 LG D G L +L+DNGV V T V A G+R+F + + AD Sbjct: 61 LGSDPEGDRLFQVLQDNGVAIAAVQRHPRLPTRQVQVLRTAQGDRQFGGFGAIACDQFAD 120 Query: 117 MLLTADELNVELIKRAAVFHYGSISLIAEPCRTAHLRAMEIAKEAGALLSYDPNLREALW 176 L A++L + A V G+I L A +A+ A + G + D N R + W Sbjct: 121 TELQAEQLPQAWFRLAKVLCLGTIPLAYPSSAIAAQQALTWANQQGMTVLLDVNWRPSFW 180 Query: 177 PSREEARTQILSIWDQADIVKVSEVELEFLTGIDSVEDDVVMKLWRPTMKLLLVTLGDQG 236 P A +I +I Q +K++ E E+L D+V D ++ +P ++ +L+T GD+G Sbjct: 181 PDPSLAPDRIRAILPQIQQLKLAREEAEWL--FDTV-DPATIQARQPQLQAVLITDGDRG 237 Query: 237 CKYYARDFHGAVPSFKVQQVDTTGAGDAFVGALLQRIVKDPSSLQDEKKLVESIKFANAC 296 C Y+ + G PSF V+ +DTTGAGDAFV A L + + +++ +I++A+A Sbjct: 238 CHYWVAGWQGHCPSFPVKAIDTTGAGDAFVAAWLAQNTQMDFQWTSAEQVQTAIRWASAA 297 Query: 297 GAITTTKKGAIPSLPTEAEVLQLIEK 322 GA+TT GAI + PT + L+ K Sbjct: 298 GALTTLNPGAIAAQPTSDAIQSLLSK 323 Lambda K H 0.319 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 262 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 324 Length adjustment: 28 Effective length of query: 295 Effective length of database: 296 Effective search space: 87320 Effective search space used: 87320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory