Align ABC transporter for L-Fucose, permease component 1 (characterized)
to candidate Synpcc7942_0526 Synpcc7942_0526 ABC-type sugar transport systems permease components-like
Query= reanno::Smeli:SM_b21104 (298 letters) >FitnessBrowser__SynE:Synpcc7942_0526 Length = 293 Score = 130 bits (328), Expect = 3e-35 Identities = 81/281 (28%), Positives = 139/281 (49%), Gaps = 7/281 (2%) Query: 8 APTLLLLPAFIVLAVFIVLPLIFSLYSSFTPF--RLTKPDSLWVFIGFRNYVNVLTNAEF 65 +P L L PA +L + + P + + Y SFT F LT+ ++G N+ +L +A F Sbjct: 9 SPYLFLAPALTILGLTVFWPALQAFYFSFTRFDYNLTRSPQ---WVGLENFQRLLNDAVF 65 Query: 66 WVAFGRTVLLLTVALNAEMFLGLGLALLVNKATYGQRALRTAMMFPMMFSPVLVGFQFKF 125 W G T + L + +FL LGLA+LVN+ G R A P++ S V+ G +++ Sbjct: 66 WKTLGNTFIYLIGVVPLLVFLPLGLAILVNRPLRGITLFRLAYYTPVIVSIVVAGIAWRW 125 Query: 126 LFNDNIGFVNNALQSL-GLTDRAIPWLIDGNLALFSIIVAEVWSSTAVFAILILAGLLAM 184 L+ + G +N Q + G + IPWL LALFS++ VW + ++ LAGL + Sbjct: 126 LYAET-GLLNQLGQLVFGEGFQPIPWLTSPALALFSVMAVTVWKGLGYYMVIYLAGLQGI 184 Query: 185 PKDPVEAAHVDGCTPWQTFRYVTWPYLMPFAFIAMTIRSLDVARAYDIVKIMTDGGPAKR 244 P + EAA +DG W+ +T P + P+ + I ++ + ++ V IMT GGP Sbjct: 185 PLELYEAAALDGSDGWRRHLDITLPLMRPYLVLVAVISAISATKVFEEVFIMTQGGPLNS 244 Query: 245 TELLWTLIGRTAYGDARMGMANAMAYVAILLSIFFTVYFFR 285 ++ + + + A+ + A + L+ + ++ R Sbjct: 245 SKTVVYYVYQQAFQKLEVSYACTVGLALFLVVLTLSLLRLR 285 Lambda K H 0.331 0.142 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 262 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 293 Length adjustment: 26 Effective length of query: 272 Effective length of database: 267 Effective search space: 72624 Effective search space used: 72624 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory