Align ABC transporter for L-Fucose, permease component 2 (characterized)
to candidate Synpcc7942_0471 Synpcc7942_0471 ABC-type sugar transport system permease component-like
Query= reanno::Smeli:SM_b21105 (288 letters) >FitnessBrowser__SynE:Synpcc7942_0471 Length = 276 Score = 140 bits (352), Expect = 4e-38 Identities = 86/279 (30%), Positives = 145/279 (51%), Gaps = 11/279 (3%) Query: 11 RRLLKVAHLAGLFLAMLVICLPGLWIVLSSLRPTVE-IMAKPPVWIPETLSLDAYRAMFS 69 R LL L + +AML+ P LW+V ++ + E I PP ++P +LD +R +++ Sbjct: 8 RSLLLYLLLGTIAVAMLI---PLLWLVSTAFKSAGEDIFQFPPQFLPTQPTLDNFRRVWT 64 Query: 70 GAGQGGVPVWDYFRNSLIVSVTSTVIALAIGLSGGYAFARYRFKAKSAIFLGFMLTRAVP 129 P+ YF NS V++ + + L Y AR FK + +FL + T +P Sbjct: 65 EN-----PLGQYFLNSTWVALLTVGLNLLFCSLAAYPLARLEFKGRQTLFLLIVATILIP 119 Query: 130 GIALSLPLFMLYARTGIIDTHFSLILTYVALNVPFTIWLIDGFFRQVPKDLAEAAQIDGC 189 + +PL++L G+ +T+ L+ Y+A F I+L+ F+ +PKDL EAA+IDGC Sbjct: 120 FQVVMIPLYVLIINLGLRNTYLGLVFPYLAS--AFGIFLLRQAFQGIPKDLEEAARIDGC 177 Query: 190 TPWQAFWQVEFPLAGPGIASAGIFAFLTSWNEYALASQITRSVNSKTLPVGLLDYTAEFT 249 +W V P A P + + IF F+ SW+++ I + TLP+G+ + F+ Sbjct: 178 NDLGVWWNVMIPSARPALITLAIFVFIGSWSDFLWPLIILDEPDRYTLPLGIATLASGFS 237 Query: 250 IDWRGMCALAVVMIVPALTLTFIIQKHLVSGLTFGAVKG 288 +DWR + A +V+ I+P + +Q+++V VKG Sbjct: 238 LDWRLVAAGSVLSILPVFGVFLALQRYIVPSAAASGVKG 276 Lambda K H 0.328 0.141 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 276 Length adjustment: 26 Effective length of query: 262 Effective length of database: 250 Effective search space: 65500 Effective search space used: 65500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory