Align ABC transporter for L-Fucose, ATPase component (characterized)
to candidate Synpcc7942_0947 Synpcc7942_0947 ATPase
Query= reanno::Smeli:SM_b21106 (365 letters) >FitnessBrowser__SynE:Synpcc7942_0947 Length = 355 Score = 275 bits (704), Expect = 1e-78 Identities = 157/360 (43%), Positives = 226/360 (62%), Gaps = 14/360 (3%) Query: 6 LKKLVKRYGALEV-VHGIDLEVKDREFIALVGPSGCGKSTTLRMIAGLEEVSGGAIEIGG 64 L++L K Y V V + L+++ EF+ L+GPSGCGKSTTLR+IAGL++ + G+I +G Sbjct: 8 LRQLRKAYSPSVVPVANLSLQLQPGEFLTLLGPSGCGKSTTLRLIAGLDQPTSGSIWLGD 67 Query: 65 RKVNDLPPRARNISMVFQSYALYPHMTVAENMGFSLKIAGRPAEEIKTRVAEAAAILDLA 124 R++ LPP R+++MVFQSYALYPH+ V +N+ L+I A EI+ R+ + A L+L Sbjct: 68 REITTLPPGDRDMAMVFQSYALYPHLNVRQNLTLGLQIRRTSAAEIEQRLQQVAHNLELD 127 Query: 125 HLLERRPSQLSGGQRQRVAMGRAIVRQPDVFLFDEPLSNLDAKLRTQVRTEIKKLHARMQ 184 HLL+RRP+QLSGGQRQRVA+GRA+VRQP VFL DEPLSNLDA LR QVR ++K L ++ Sbjct: 128 HLLDRRPAQLSGGQRQRVALGRALVRQPSVFLLDEPLSNLDALLREQVRAQMKALFSQQA 187 Query: 185 ATMIYVTHDQVEAMTLSDRIVIMRDGHIEQVGTPEDVFRRPATKFVAGFIGSPPMNMEEA 244 + ++YVTHDQ EA++LS RI I+ GH++Q+ +P+ +++ PA FVAGFIGSP MN+ Sbjct: 188 SPVVYVTHDQTEALSLSHRIAILNGGHLQQLDSPDRIYQAPANAFVAGFIGSPRMNLLPL 247 Query: 245 VLTDGKLAFASGATLPLPPRFRSLVREGQKVTFGLRPDDVYPSGHGLHAGDADAVHEIEL 304 + G+ A+ LP+P S + +V +GLRP+ L + I + Sbjct: 248 PIHSGQ-AWLGSRALPIP----SHLAARSQVLWGLRPEH-------LKLATPEVERAIPV 295 Query: 305 PVTITEPLGNETLVFTQFNGRDWVS-RMLNPRPLRPGEAVPMSFDLARAHLFDGETGRAL 363 + +TE LG + L+ V R+L P + ++F+ H F TG L Sbjct: 296 QLHLTENLGMQRLLTVAIAANPEVRLRLLMPSDQPIPTDLQVTFEPESQHWFCPSTGDRL 355 Lambda K H 0.320 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 384 Number of extensions: 18 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 355 Length adjustment: 29 Effective length of query: 336 Effective length of database: 326 Effective search space: 109536 Effective search space used: 109536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory